Protein
MIA_01240_1
Length
97 amino acids
Browser: contig02:134938-135232-
Protein function
| CGD closest match: | CAL0000198304 | orf19.6222.1 | Uncharacterized protein |
|---|
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05984_1 | 66.667% | 75 | 7.14e-29 | MCA_05984_1 |
| A0A167E7Q6_9ASCO | 66.102% | 59 | 1.17e-25 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_4687 PE=4 SV=1 |
| UniRef50_A0A167E7Q6 | 66.102% | 59 | 3.21e-22 | Uncharacterized protein n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A167E7Q6_9ASCO |
| A0A0J9X3R1_GEOCN | 55.952% | 84 | 6.58e-24 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA01s11499g PE=4 SV=1 |
| A0A1E3PL46_9ASCO | 61.017% | 59 | 8.20e-22 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83007 PE=4 SV=1 |
| A0A060TH37_BLAAD | 56.897% | 58 | 2.39e-20 | ARAD1D35750p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D35750g PE=4 SV=1 |
| A0A1E4T9Q4_9ASCO | 42.373% | 59 | 1.05e-15 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_29589 PE=4 SV=1 |
| B5FVH2_YARLI | 47.368% | 57 | 7.50e-13 | YALI0E08085p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E08085g PE=4 SV=1 |
| A0A1D8PDY6_CANAL | 42.857% | 56 | 9.33e-12 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6222.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0430
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_01240_1 MDSARLNAIIENTYIPSGNNKKSDAVPAHHPSLIMLDNQTDTTHHLKCGCCGGACITENAWWDKKKALDAKERPSYRRGS SSSSISTVSSYSSSSGY
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.