Protein
MIA_01214_1
Length
324 amino acids
Browser: contig02:73091-74179-
Protein function
| EGGNOG: | 0PJDX | GCN3 | Translation initiation factor eIF-2B |
|---|---|---|---|
| SGD closest match: | S000001734 | GCN3 | Translation initiation factor eIF-2B subunit alpha |
| CGD closest match: | CAL0000186383 | GCN3 | Translation initiation factor eIF2B subunit alpha |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_03725_1 | 80.19% | 313 | 4e-156 | MCA_03725_1 |
| A0A0J9X401_GEOCN | 70.34% | 327 | 1e-136 | Similar to Saccharomyces cerevisiae YKR026C GCN3 Alpha subunit of the translation initiation factor eIF2B OS=Geotrichum candidum GN=BN980_GECA02s01726g PE=3 SV=1 |
| A0A1E3PLN0_9ASCO | 66.22% | 299 | 2e-119 | Alpha subunit of the translation initiation factor eIF2B OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_40995 PE=3 SV=1 |
| A0A060THL9_BLAAD | 67.47% | 292 | 8e-116 | ARAD1D39314p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D39314g PE=3 SV=1 |
| Q6CBJ8_YARLI | 61.59% | 302 | 7e-107 | YALI0C18161p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C18161g PE=3 SV=1 |
| EI2BA_YEAST | 56.62% | 302 | 3e-94 | Translation initiation factor eIF-2B subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN3 PE=1 SV=1 |
| UniRef50_P14741 | 56.62% | 302 | 8e-91 | Translation initiation factor eIF-2B subunit alpha n=85 Tax=Saccharomycetales TaxID=4892 RepID=EI2BA_YEAST |
| A0A1D8PQT4_CANAL | 58.50% | 306 | 6e-94 | Translation initiation factor eIF2B subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GCN3 PE=3 SV=1 |
| A0A1E4TB53_9ASCO | 56.86% | 299 | 1e-90 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3647 PE=3 SV=1 |
| A0A167BX65_9ASCO | 70.80% | 137 | 7e-53 | Translation initiation factor eIF2B subunit alpha OS=Sugiyamaella lignohabitans GN=GCN3 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0030
Protein family membership
- Initiation factor 2B-related (IPR000649)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
SSF100950 (NagB/Rpi...)
Protein sequence
>MIA_01214_1 MSIETKNGSVQSSLAVVPIYADDGTLDIKATYLKVLEDDPEITMPVAAIESLVVLLSVTQTSTSSELIKVLADATSKLKK GVLNSVSLTAGCDLFTRFVLRNINDMGDWEACKAHLMKNGRLFAQRAKEARKTIAHNGLPFIRDDDVILVHAHSRAVISL LLLAASKLIRFRVYVTESRVTENGYKTAEILRNNNIPVCLIADATVGYVIQKVDKIFVGAEGVAESGGVINASGTYQIGV LAKDTKVPFYVVAESHKFVRLYPVSPSDIATDYPLEFTTETRKDELENLPTTDFTPHQYVTALITDIGVLTTSGVSEELI KIYV
GO term prediction
Biological Process
GO:0044237 cellular metabolic process
Molecular Function
None predicted.
Cellular Component
None predicted.