Protein
MIA_01200_1
Length
312 amino acids
Browser: contig02:44364-45359-
Protein function
EGGNOG: | 0PI47 | PGUG_01421 | CaaX prenyl |
---|---|---|---|
SGD closest match: | S000004887 | RCE1 | CAAX prenyl protease 2 |
CGD closest match: | CAL0000185732 | RCE1 | CAAX prenyl protease |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_03224_1 | 40.719% | 334 | 3.56e-74 | MCA_03224_1 |
A0A0J9XGM3_GEOCN | 41.270% | 315 | 4.14e-68 | Similar to Saccharomyces cerevisiae YMR274C RCE1 Type II CAAX prenyl protease involved in the proteolysis and maturation of Ras and the a-factor mating pheromone OS=Geotrichum candidum GN=BN980_GECA15s01176g PE=4 SV=1 |
UniRef50_A0A0J9XGM3 | 41.270% | 315 | 8.47e-65 | Similar to Saccharomyces cerevisiae YMR274C RCE1 Type II CAAX prenyl protease involved in the proteolysis and maturation of Ras and the a-factor mating pheromone n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XGM3_GEOCN |
Q6C2J5_YARLI | 34.256% | 289 | 2.11e-44 | YALI0F07359p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F07359g PE=4 SV=1 |
A0A060TAD0_BLAAD | 36.786% | 280 | 6.40e-43 | ARAD1D17776p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D17776g PE=4 SV=1 |
RCE1_YEAST | 30.943% | 265 | 9.30e-29 | CAAX prenyl protease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCE1 PE=1 SV=1 |
A0A1D8PM34_CANAL | 26.471% | 272 | 1.25e-20 | CAAX prenyl protease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RCE1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5521
Predicted cleavage: 48
Protein family membership
- CAAX amino terminal protease (IPR003675)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_01200_1 MPVITSDLQPHLSALKASIGSLVLTIGYVLVFYIRSSTRTSVTQKRDDPNVIKERIKVITIYSFFIDFVFVPIVLLITHV YDSYIQVIGVLRIFGGWKTNGIEVAIDTLKALLLVSILFIGPICNSLFFDQELQSEATTFNIKRIASPSILLQNLNKFFF SPQGLRNYVFGPFTEELVFRSGILSLYLSSNVSKRFLIFCCPLFFGVAHLHHAYELFLEAKYKIMDILLVCSFQFFYTYL FGIFSGFLFLRLGTIWPCIATHTFCNLMGVPSFGSVGSNYIHLWVYRLLLILGAYGFYHYLFFLTTSDNQIL
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0016020 membrane