Protein

MIA_01193_1

Length
429 amino acids

Browser: contig02:24637-25927+

Protein function

EGGNOG:0PI7CFG09444.1Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives (By similarity)
SGD closest match:S000005722LIP5Lipoyl synthase, mitochondrial
CGD closest match:CAL0000198437LAB5Lipoyl synthase, mitochondrial

Protein alignments

%idAln lengthE-value
A0A0J9X5Q9_GEOCN81.287%3420.0Lipoyl synthase, mitochondrial OS=Geotrichum candidum GN=BN980_GECA02s05400g PE=3 SV=1
MCA_04515_173.016%3780.0MCA_04515_1
A0A167E7A1_9ASCO76.724%3480.0Lipoyl synthase, mitochondrial OS=Sugiyamaella lignohabitans GN=LIP5 PE=3 SV=1
A0A060T8A9_BLAAD74.780%3410.0Lipoyl synthase, mitochondrial OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D05368g PE=3 SV=1
LIPA_YARLI76.540%3410.0Lipoyl synthase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E10571g PE=3 SV=1
A0A1E3PM43_9ASCO76.106%3396.02e-178Lipoyl synthase, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_69669 PE=3 SV=1
LIPA_YEAST65.909%3962.98e-172Lipoyl synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LIP5 PE=1 SV=1
LIPA_CANAL67.945%3659.03e-172Lipoyl synthase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LAB5 PE=3 SV=1
UniRef50_A0A1L0C1P869.628%3491.50e-160Lipoyl synthase, mitochondrial n=1 Tax=[Candida] intermedia TaxID=45354 RepID=A0A1L0C1P8_9ASCO

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6926

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 429

Detailed signature matches

  1. Family IPR003698
    Lipoyl synthase
    1. MF_00206 (Lipoyl_synth)
    2. TIGR00510
    3. SFLDG01058 (lipoyl_...)
  2. Domain IPR013785
    Aldolase-type TIM barrel
    1. G3DSA:3.20.20.70
  3. Domain IPR031691
    Lipoyl synthase, N-terminal
    1. PF16881 (LIAS_N)
  4. Domain IPR007197
    Radical SAM
    1. PF04055 (Radical_SAM)
  5. Domain IPR006638
    Elongator protein 3/MiaB/NifB
    1. SM00729 (MiaB)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SFLDF00271 (lipoyl_...)
  2. SSF102114 (Radical ...)
  3. cd01335 (Radical_SAM)
  4. mobidb-lite (disord...)

Residue annotation

  1. SFLDF00271
  2. SFLDG01058
  3. FeS/SAM binding si...

Protein sequence

>MIA_01193_1
MSRKFISPIISSFEGLCDKGYGANKPIRALATLSKSHKDLSSDQVNSSISKKNNSKDSILSEAATENPKSKQRRTRFTDK
LNKGPSFDDFLRGRINPDDFMSLDPVAASQPTKHVNLPSWLKTKIPKGSNFSKIKDDVRDLKLHTVCEEARCPNIGECWG
GKDKSKATATIMLMGDTCTRGCRFCSVKTNRTPPPLDPNEPENTAAAIAKWGLGYVVLTTVDRDDLVDGGAHHFADTVKR
IKYKAPNILVECLTGDFRGDKNMVSLMANSGLDVFAHNLETVEDLTPFVRDRRATFQQSLEVLKHAKESNPNVITKTSMM
LGFGETDEQVDEALKKLRTIAKCDIVTFGQYMRPTKRHLKVVEYVTPDKFDYWKKRAMDLGFIYCASGPLVRSSYKAGEV
FIENVLKKRQMKEESLKSTPQQISPSNVL

GO term prediction

Biological Process

GO:0009107 lipoate biosynthetic process

Molecular Function

GO:0003824 catalytic activity
GO:0016992 lipoate synthase activity
GO:0051536 iron-sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding

Cellular Component

None predicted.