Protein

MIA_01191_1

Length
249 amino acids


Browser: contig02:20860-21610-

Protein function

EGGNOG:0PRFTIRC22Is probably involved in a pathway contributing to genomic integrity
SGD closest match:S000000727IRC22Increased recombination centers protein 22
CGD closest match:CAL0000174666IRC22-1Increased recombination centers protein 22-1

Protein alignments

%idAln lengthE-value
MCA_03296_148.918%2312.83e-71MCA_03296_1
A0A0J9XGN1_GEOCN38.679%2128.89e-43Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA15s01231g PE=4 SV=1
UniRef50_A0A0J9XGN138.679%2121.82e-39Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XGN1_GEOCN
A0A060T9V6_BLAAD34.123%2112.08e-36ARAD1D17644p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D17644g PE=4 SV=1
A0A167DHC8_9ASCO30.864%2432.71e-27Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_1199 PE=4 SV=1
Q6C5B4_YARLI30.220%1825.57e-25YALI0E19492p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E19492g PE=4 SV=1
IR221_CANAL31.551%1871.11e-21Increased recombination centers protein 22-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IRC22-1 PE=3 SV=1
IRC22_YEAST29.918%2441.75e-18Increased recombination centers protein 22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC22 PE=1 SV=1
A0A1E3PKI3_9ASCO27.419%1865.99e-17Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82799 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.5302

Protein family membership

None predicted.

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)
  2. mobidb-lite (disord...)

Protein sequence

>MIA_01191_1
MKLISFGLLLSPFISVLAASSTGTTDIPTAENIITNVVFPDSNNPKSLPEFVNDQETNVQFQFKNNENTPIHIAGYFGSF
YYNKKGLREKQPYANLTTAKIGPLAIEPGKSSTFDAKIMVNLPPEDFDLIISFFVGFQGEVIVVENKPLKVTISDAPVSF
FNPKFLFVQLVFGLTIGGIGLAIYYLVLLPYIEDSNTSKKQTVLKKTVQEKKKSVNPGDKGYDESWIPSHHLKSSNSTAN
PSLKQKKSA

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.