Protein

MIA_01165_1

Length
240 amino acids

Browser: contig01:3324479-3325246-

Protein function

EGGNOG:0PG6VFG09391.1EF hand domain protein

Protein alignments

%idAln lengthE-value
MCA_03539_137.662%2311.84e-42MCA_03539_1
A0A060T5S6_BLAAD33.663%2021.48e-32ARAD1B06182p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B06182g PE=4 SV=1
UniRef50_A0A060T5S633.663%2023.64e-29ARAD1B06182p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060T5S6_BLAAD
A0A0J9XGK9_GEOCN26.842%1902.08e-20Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA15s02771g PE=4 SV=1
Q6C6M3_YARLI46.053%761.75e-19YALI0E08228p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E08228g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0409

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 240

Detailed signature matches

  1. Domain IPR000433
    Zinc finger, ZZ-type
    1. PF00569 (ZZ)
    2. PS01357 (ZF_ZZ_1)
    3. SM00291 (zz_5)
    4. PS50135 (ZF_ZZ_2)
  2. Domain IPR011992
    EF-hand domain pair
    1. SSF47473 (EF-hand)
  3. Domain IPR002048
    EF-hand domain
    1. PS50222 (EF_HAND_2)
  4. SITE IPR018247
    EF-Hand 1, calcium-binding site
    1. PS00018 (EF_HAND_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.23...
  2. SSF57850 (RING/U-box)
  3. cd02340 (ZZ_NBR1_like)
  4. mobidb-lite (disord...)

Residue annotation

  1. zinc cluster 1 cd0...
  2. Zinc-binding sites...
  3. putative charged b...
  4. putative hydrophob...
  5. zinc cluster 2 cd0...

Protein sequence

>MIA_01165_1
MNLKSSNIVSDLEDSSDEEVQNEDQLLNQIPFNLSELKDTEQEILLLLFHLAERCTSNQSYTHHGVSCNNCGMSPLRGVR
FRCIECPDFDLCRHCQTTHIHNKSHSFLKTQIAIPLNFLSRVFILPKTVPMQKKQYEVLPEHIIQNLTAELLVHRDTILE
TYERFCMFAGIYSNSSNKVYGISKYRFLECIIPSIDDEILADANFRYYDRNKDGIIDFVEYFKSISLTYSSQSEEYYFGK

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005509 calcium ion binding
GO:0008270 zinc ion binding

Cellular Component

None predicted.