Protein

MIA_01144_1

Length
242 amino acids


Browser: contig01:3271605-3272334+

Protein function

EGGNOG:0PKPVFG01338.1proteasome regulatory particle subunit
SGD closest match:S000003464NAS6Probable 26S proteasome regulatory subunit p28
CGD closest match:CAL0000195534orf19.5961Uncharacterized protein

Protein alignments

%idAln lengthE-value
MCA_02305_165.984%2441.31e-116MCA_02305_1
A0A0J9XBH2_GEOCN56.250%2406.98e-92Similar to Saccharomyces cerevisiae YGR232W NAS6 Proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP) OS=Geotrichum candidum GN=BN980_GECA08s00879g PE=4 SV=1
UniRef50_A0A0J9XBH256.250%2401.43e-88Similar to Saccharomyces cerevisiae YGR232W NAS6 Proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XBH2_GEOCN
A0A060TCQ6_BLAAD56.466%2321.34e-85ARAD1D40590p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D40590g PE=4 SV=1
A0A167F1Q1_9ASCO51.037%2415.16e-71Nas6p OS=Sugiyamaella lignohabitans GN=NAS6 PE=4 SV=1
Q6CDE2_YARLI47.845%2329.38e-68YALI0C01221p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C01221g PE=4 SV=1
Q5ANE2_CANAL42.857%2522.58e-58Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5961 PE=4 SV=1
PSD10_YEAST43.478%2309.56e-56Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS6 PE=1 SV=1
A0A1E3PLE8_9ASCO30.075%1337.84e-09Uncharacterized protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_5524 PE=4 SV=1
A0A1E4TCA3_9ASCO28.986%1382.52e-07Palmitoyltransferase (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_14350 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1849

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Repeat
1 50 100 150 200 242

Detailed signature matches

    1. PF12796 (Ank_2)
    2. PS50297 (ANK_REP_RE...)
    3. SSF48403 (Ankyrin r...)
    4. cd00204 (ANK)
    1. SM00248 (ANK_2a)
    2. PS50088 (ANK_REPEAT)
    3. PR01415 (ANKYRIN)
Unintegrated signatures no IPR
Unintegrated signatures
  1. PF13637 (Ank_4)

Protein sequence

>MIA_01144_1
MTDPFNPQSFPLHDSARDGKNLLVKELSQNDPSSILAKDGDGRTPLFWAASASNTEGLSILLKKIKETPELSKKFDIDDT
DAGGWTLLHITSSTGSLAGIDLLEPFEPDVDAQTAAGQTALHFAVSKGHIDVVRKLIASPLKASVRIKDKRGQIPLHRAA
ALGSLPITKTLVEEGKSPINTSDSTGWTPLYHALAEGHGDVAVYLIKHGADLEREDSEGKKPLDVSYDLKTREFVEAALK
DS

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005515 protein binding

Cellular Component

None predicted.