Protein

MIA_01143_1

Length
243 amino acids


Browser: contig01:3270388-3271185-

Protein function

EGGNOG:0PN72PGUG_04209conserved hypothetical protein
SGD closest match:S000005434YOL073CUncharacterized membrane protein YOL073C
CGD closest match:CAL0000195962orf19.5984Uncharacterized protein

Protein alignments

%idAln lengthE-value
A0A0J9XBH3_GEOCN56.306%2225.11e-75Similar to Saccharomyces cerevisiae YOL073C Subunit of the DSC ubiquitin ligase comple OS=Geotrichum candidum GN=BN980_GECA08s00890g PE=4 SV=1
UniRef50_A0A0J9XBH356.306%2221.05e-71Similar to Saccharomyces cerevisiae YOL073C Subunit of the DSC ubiquitin ligase comple n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XBH3_GEOCN
MCA_02306_157.949%1951.58e-64MCA_02306_1
A0A060TD71_BLAAD44.068%2365.10e-58ARAD1D40612p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D40612g PE=4 SV=1
Q6CAQ3_YARLI38.934%2441.35e-51YALI0D00847p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D00847g PE=4 SV=1
A0A1E3PMM6_9ASCO43.668%2294.54e-51Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82444 PE=4 SV=1
Q5ANB9_CANAL29.341%1673.08e-15Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5984 PE=4 SV=1
YO073_YEAST27.426%2374.24e-15Uncharacterized membrane protein YOL073C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL073C PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3876

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 243

Detailed signature matches

    1. SSF144091 (Rhomboid...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_01143_1
MFVYTLSGFKNAPVTKFFICVLVLIPIFVSLLDIRYLFDLQVVPHLLVWHQWWRLPLNQLLYTSQSNIITATIYFYNLRV
IERLFGSHKYLSYLVLIYGLSLFFVPLSNLILSYTPILSSLFQQLASTYIPPGPTSLVFATLVLYKEVIPPVFKFQITPI
SSPFTLILSDKIFVYFIAADLLLLGLPGSLNPALVGWVLGHLIYLELIPGKNWRIPLYFFTKAKPQTPPLYSRRESQPVT
TNN

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0004252 serine-type endopeptidase activity

Cellular Component

GO:0016021 integral component of membrane