Protein
MIA_01110_1
Length
601 amino acids
Browser: contig01:3176752-3178558+
Protein function
EGGNOG: | 0PFHS | PGUG_05398 | Regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases (By similarity) |
---|---|---|---|
SGD closest match: | S000000193 | BRN1 | Condensin complex subunit 2 |
CGD closest match: | CAL0000196556 | BRN1 | Condensin complex subunit 2 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A060T814_BLAAD | 23.611% | 648 | 4.18e-22 | Condensin complex subunit 2 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C32736g PE=3 SV=1 |
UniRef50_A0A060T814 | 23.611% | 648 | 1.03e-18 | Condensin complex subunit 2 n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060T814_BLAAD |
A0A0J9XBR9_GEOCN | 26.947% | 475 | 2.57e-21 | Condensin complex subunit 2 OS=Geotrichum candidum GN=BN980_GECA09s02023g PE=3 SV=1 |
A0A167E8B0_9ASCO | 27.735% | 393 | 8.14e-18 | Condensin complex subunit 2 OS=Sugiyamaella lignohabitans GN=BRN1 PE=3 SV=1 |
MCA_04960_1 | 25.229% | 436 | 5.01e-17 | MCA_04960_1 |
Q6CFV1_YARLI | 24.593% | 492 | 1.10e-15 | Condensin complex subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B03476g PE=3 SV=1 |
A0A1E3PCR0_9ASCO | 31.765% | 170 | 1.44e-15 | Barren-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53441 PE=4 SV=1 |
A0A1D8PMC8_CANAL | 28.194% | 227 | 2.42e-13 | Condensin complex subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BRN1 PE=3 SV=1 |
CND2_YEAST | 27.072% | 181 | 5.03e-09 | Condensin complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRN1 PE=1 SV=3 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0180
Protein family membership
- Condensin complex subunit 2/barren (IPR022816)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_01110_1 MDDSDSFYASRCSSSESSDFERPYDWDLLVQEASAIDSKNAHIWSNSLIDRFHWLDPLFDNDRINFQKTGYALDHCVKLY CARIDFVANAAIQLFNSVNINVNKKTRKQPAEFEQDSDVEEESDDEALHSRQLQQRHKKSCTLAPNFDAIRNKIRNENTF ISPLFYSKQSQFKEGSAKTLFLNLLMLDSNGTKIFYGDDVLLNEKVSLKEEKRREEIQQEIDLREANVAQINLRRVYRKF FQKKGDLDIKYLSICPSLPYLESLVNGASIQPREYTRIIRQKTPDVDLFEDSTYERISFDMDFENSDDAEADTKPLETVL NVLETQNILNYENSNHIENEESPAEHWRIQNIKGAIEGEEGESQFSVVPKQRKNERIRKPRVLIDFLTNDDDPFNEAEIF KEGGPQSKIPLDKYLANCNELTEFNGQTDQDMFAKMFFRETVPLFNDEDCDETFYDNDYCDIPDYHDSNSVSFSDIGRNE EIIQENEPIQSITYFTYSKFSTYVNFLELKNTMDECLLASFSSQEKDGITGQVSSDYQLPDSFNEISHEVMDIFENDTQL NLGKPTKATCFLALLSLANDYRLQLDPTKYHDDVVIRFQQN
GO term prediction
Biological Process
GO:0007076 mitotic chromosome condensation
Molecular Function
None predicted.
Cellular Component
GO:0000796 condensin complex