Protein

MIA_01048_1

Length
373 amino acids


Browser: contig01:2997959-2999153-

Protein function

EGGNOG:0PGTCSEC62translocation protein, Sec62
SGD closest match:S000006015SEC62Translocation protein SEC62
CGD closest match:CAL0000199574SEC62Translocation protein SEC62

Protein alignments

%idAln lengthE-value
MCA_00761_159.64%3322e-105MCA_00761_1
A0A0J9X3W1_GEOCN54.98%3313e-104Similar to Saccharomyces cerevisiae YPL094C SEC62 Essential subunit of Sec63 complex (Sec63p, Sec62p, Sec66p and Sec72p) OS=Geotrichum candidum GN=BN980_GECA02s01044g PE=4 SV=1
UniRef50_A0A0J9X3W154.98%3316e-101Similar to Saccharomyces cerevisiae YPL094C SEC62 Essential subunit of Sec63 complex (Sec63p, Sec62p, Sec66p and Sec72p) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X3W1_GEOCN
A0A060T9D7_BLAAD54.47%2352e-77ARAD1D17028p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D17028g PE=4 SV=1
A0A1E3PEN9_9ASCO55.65%2301e-74Translocation protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52830 PE=4 SV=1
SEC62_YARLI56.11%2218e-73Translocation protein SEC62 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC62 PE=3 SV=2
A0A1E4TJK9_9ASCO46.08%2174e-45Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_447 PE=4 SV=1
SEC62_CANAL43.78%2172e-40Translocation protein SEC62 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC62 PE=3 SV=1
SEC62_YEAST36.89%2256e-36Translocation protein SEC62 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC62 PE=1 SV=2
A0A161HGJ3_9ASCO65.67%679e-18Sec63 complex subunit SEC62 OS=Sugiyamaella lignohabitans GN=SEC62 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0272

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)
  2. mobidb-lite (disord...)

Protein sequence

>MIA_01048_1
MTSITIGPPDLKTVDPTMLAVAKFLHGNSILKQREGILNDRRYMFFKVKRAARALESDSYKKKQSKVNSRLPPVASHDQA
LQLLRQLPLQKLAFQAVKLDTDDAIAKGLKPRPGVPVLQISPQQQFLEDQYVVWFYEPVSLLSHLYAVLAVAGIFGVVLF
PLWPLALRRGVWYLSMGLLGLIAAFFGLAIVRLILFVITYVVVKPGIWIFPNLFEDLGVLDSFVPLWSWHGADAMKIHRL
AKKKKKSKQQKARKLEKQKANEAAGKGTKGAAAAGAAGGMPGVNPQLLAQLQKLNARIQAISAEREKAGKPMAQEEVQKL
GQALIAEYMSPLQPGGPGGAPSPSGTQGGAPAAAAARPATNRSVKIEEIEDED

GO term prediction

Biological Process

GO:0015031 protein transport

Molecular Function

GO:0008565 protein transporter activity

Cellular Component

GO:0016021 integral component of membrane
GO:0030176 integral component of endoplasmic reticulum membrane