Protein

MIA_01037_1

Length
155 amino acids


Browser: contig01:2975460-2976282+

Protein function

EGGNOG:0PN27UBC13ubiquitin-conjugating enzyme
SGD closest match:S000002499UBC13Ubiquitin-conjugating enzyme E2 13
CGD closest match:CAL0000190288orf19.933E2 ubiquitin-conjugating protein

Protein alignments

%idAln lengthE-value
MCA_02578_189.677%1557.91e-103MCA_02578_1
A0A060TCH0_BLAAD80.795%1516.82e-90ARAD1B16478p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B16478g PE=3 SV=1
A0A0J9X8B8_GEOCN80.000%1502.21e-88Similar to Saccharomyces cerevisiae YLR306W UBC12 Enzyme that mediates the conjugation of Rub1p OS=Geotrichum candidum GN=BN980_GECA04s03431g PE=3 SV=1
Q6CDH2_YARLI79.866%1491.66e-87YALI0C00561p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C00561g PE=3 SV=1
UniRef50_Q6FST179.592%1471.14e-81Uncharacterized protein n=19 Tax=Eukaryota TaxID=2759 RepID=Q6FST1_CANGA
A0A1E3PHL4_9ASCO79.054%1482.61e-85Ubiquitin-conjugating enzyme OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52677 PE=3 SV=1
Q5A513_CANAL77.027%1482.74e-82E2 ubiquitin-conjugating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.933 PE=3 SV=1
UBC13_YEAST77.551%1472.78e-82Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBC13 PE=1 SV=1
A0A1E4TBF9_9ASCO75.862%1452.77e-81Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_27036 PE=3 SV=1
A0A161HN35_9ASCO54.054%1113.51e-38E2 ubiquitin-conjugating protein UBC4 OS=Sugiyamaella lignohabitans GN=UBC4 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9203

Protein family membership

None predicted.

Domains and repeats

1 20 40 60 80 100 120 140 155

Detailed signature matches

    1. SSF54495 (UBC-like)
    1. PS50127 (UBIQUITIN_...)
    2. cd00195 (UBCc)
    3. PF00179 (UQ_con)
    1. PS00183 (UBIQUITIN_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SM00212 (ubc_7)

Residue annotation

  1. E3 interaction res...
  2. Ub thioester inter...
  3. active site cystei...

Protein sequence

>MIA_01037_1
MANLLSKRIIRETERLVSDPVPGITAVPHDDNLRYFDVTIDGPAQSPYEGGVFRLELFLPEDYPTVVVAPKVRFITKIYH
PNIDRLGRICLDVLKNNWSPAQQIGTILLSIQALLGAPNPNDPLANDVAEHWKEDEQGAINTAKEWTQKYAVPSS

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.