Protein

MIA_01026_1

Length
270 amino acids


Browser: contig01:2945706-2946519-

Protein function

EGGNOG:0PH9YCAP2F-actin-capping proteins bind in a Ca(2 )-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments
SGD closest match:S000001296CAP2F-actin-capping protein subunit beta
CGD closest match:CAL0000197252orf19.4597F-actin-capping protein subunit beta

Protein alignments

%idAln lengthE-value
MCA_00774_169.318%2646.13e-136MCA_00774_1
A0A0J9XDT2_GEOCN68.110%2541.05e-127Similar to Saccharomyces cerevisiae YIL034C CAP2 Beta subunit of the capping protein (CP) heterodimer (Cap1p and Cap2p) which binds to the barbed ends of actin filaments OS=Geotrichum candidum GN=BN980_GECA11s01033g PE=4 SV=1
A0A060TE91_BLAAD61.417%2543.34e-116ARAD1D13618p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D13618g PE=4 SV=1
UniRef50_A0A0E9NN5459.921%2528.64e-97Glucose-6-phosphate 1-dehydrogenase n=2 Tax=Saitoella complicata NRRL Y-17804 TaxID=698492 RepID=A0A0E9NN54_9ASCO
A0A1E3PQJ6_9ASCO56.522%2531.12e-108F-actin capping protein, beta subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45602 PE=4 SV=1
CAPZB_YARLI58.366%2575.93e-99F-actin-capping protein subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CAP2 PE=3 SV=2
A0A1E4TBU3_9ASCO54.800%2501.31e-87Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3763 PE=4 SV=1
Q5AMP9_CANAL46.043%2789.95e-77F-actin-capping protein subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4597 PE=4 SV=1
CAPZB_YEAST47.347%2452.94e-73F-actin-capping protein subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAP2 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6813

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PR00192 (FACTINCAPB)
    2. PF01115 (F_actin_cap_B)
    1. PS00231 (F_ACTIN_CA...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF90096 (Subunits ...)

Protein sequence

>MIA_01026_1
MADDSYDASLDLLRRLNPRNIGRNLNTLCQVVPSLAEDLLSSVDQPLGVKTCAQTKRQFLTCDYNRDGDSYRSPWSGEYQ
PALADGAVPGPELRTLEVAFNDAFDIYRDLYYEGGVSSAYLWEVDGGFAGVALFKKSATEHKVGESGVWDSIHVFEVEKV
SRKTANYKLTSTVILDIAGKNKVLGSLNLGGNLTRQAEQTLAVGDESGSSHITNIGTMVEEMESKLRNVLNEVYFGKTRD
IVGDLRSIASATETSYEKSLKTQVAKDLGA

GO term prediction

Biological Process

GO:0030036 actin cytoskeleton organization
GO:0051016 barbed-end actin filament capping

Molecular Function

GO:0003779 actin binding

Cellular Component

GO:0005737 cytoplasm
GO:0008290 F-actin capping protein complex