Protein
MIA_01026_1
Length
270 amino acids
Browser: contig01:2945706-2946519-
Protein function
| EGGNOG: | 0PH9Y | CAP2 | F-actin-capping proteins bind in a Ca(2 )-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments |
|---|---|---|---|
| SGD closest match: | S000001296 | CAP2 | F-actin-capping protein subunit beta |
| CGD closest match: | CAL0000197252 | orf19.4597 | F-actin-capping protein subunit beta |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_00774_1 | 69.318% | 264 | 6.13e-136 | MCA_00774_1 |
| A0A0J9XDT2_GEOCN | 68.110% | 254 | 1.05e-127 | Similar to Saccharomyces cerevisiae YIL034C CAP2 Beta subunit of the capping protein (CP) heterodimer (Cap1p and Cap2p) which binds to the barbed ends of actin filaments OS=Geotrichum candidum GN=BN980_GECA11s01033g PE=4 SV=1 |
| A0A060TE91_BLAAD | 61.417% | 254 | 3.34e-116 | ARAD1D13618p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D13618g PE=4 SV=1 |
| UniRef50_A0A0E9NN54 | 59.921% | 252 | 8.64e-97 | Glucose-6-phosphate 1-dehydrogenase n=2 Tax=Saitoella complicata NRRL Y-17804 TaxID=698492 RepID=A0A0E9NN54_9ASCO |
| A0A1E3PQJ6_9ASCO | 56.522% | 253 | 1.12e-108 | F-actin capping protein, beta subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45602 PE=4 SV=1 |
| CAPZB_YARLI | 58.366% | 257 | 5.93e-99 | F-actin-capping protein subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CAP2 PE=3 SV=2 |
| A0A1E4TBU3_9ASCO | 54.800% | 250 | 1.31e-87 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3763 PE=4 SV=1 |
| Q5AMP9_CANAL | 46.043% | 278 | 9.95e-77 | F-actin-capping protein subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4597 PE=4 SV=1 |
| CAPZB_YEAST | 47.347% | 245 | 2.94e-73 | F-actin-capping protein subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAP2 PE=1 SV=3 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6813
Protein family membership
- F-actin-capping protein subunit beta (IPR001698)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PS00231 (F_ACTIN_CA...)
-
no IPR
Unintegrated signatures
-
SSF90096 (Subunits ...)
Protein sequence
>MIA_01026_1 MADDSYDASLDLLRRLNPRNIGRNLNTLCQVVPSLAEDLLSSVDQPLGVKTCAQTKRQFLTCDYNRDGDSYRSPWSGEYQ PALADGAVPGPELRTLEVAFNDAFDIYRDLYYEGGVSSAYLWEVDGGFAGVALFKKSATEHKVGESGVWDSIHVFEVEKV SRKTANYKLTSTVILDIAGKNKVLGSLNLGGNLTRQAEQTLAVGDESGSSHITNIGTMVEEMESKLRNVLNEVYFGKTRD IVGDLRSIASATETSYEKSLKTQVAKDLGA
GO term prediction
Biological Process
GO:0030036 actin cytoskeleton organization
GO:0051016 barbed-end actin filament capping
Molecular Function
GO:0003779 actin binding
Cellular Component
GO:0005737 cytoplasm
GO:0008290 F-actin capping protein complex