Protein
MIA_00741_1
Length
180 amino acids
Browser: contig01:2102669-2103278-
Protein function
| EGGNOG: | 0PP64 | FG10297.1 | Nadh-ubiquinone oxidoreductase |
|---|---|---|---|
| CGD closest match: | CAL0000195285 | NUO2 | Nuo2p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_06120_1 | 74.725% | 182 | 1.34e-98 | MCA_06120_1 |
| A0A0J9XI57_GEOCN | 68.508% | 181 | 2.46e-91 | NUZM subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA18s02386g PE=4 SV=1 |
| A0A060TA43_BLAAD | 60.989% | 182 | 9.11e-81 | ARAD1C42196p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C42196g PE=4 SV=1 |
| Q6CI10_YARLI | 56.593% | 182 | 3.44e-70 | YALI0A02651p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A02651g PE=4 SV=1 |
| UniRef50_A0A1E3PUT5 | 56.354% | 181 | 1.10e-64 | Uncharacterized protein n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3PUT5_LIPST |
| Q5AEI1_CANAL | 51.366% | 183 | 6.64e-62 | Nuo2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NUO2 PE=4 SV=1 |
| A0A1E4TIL3_9ASCO | 48.352% | 182 | 8.63e-56 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_72940 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3964
Predicted cleavage: 46
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_00741_1 MSGGPVPVTKKYTVMSKGIWEKLRQVLTLVPNRSSGNPIVAWYRMPSPSSHPENEHYSDPATLPTSDIASNPYYGRDHRR NYPRIAYYDQTLTAGLLKLGSAASPRIADGNAGTKELAAISEEKLTSVIASANKDVILGEVLEKNGQPPIPPALNKKKWK ILSAAQSGMYDFKYPVRTFN
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.