Protein

MIA_00693_1

Length
69 amino acids


Browser: contig01:1992963-1993331-

Protein function

EGGNOG:0PQU4TFB5Component of the general transcription and DNA repair factor IIH (TFIIH), which is essential for both basal and activated transcription, as well as for nucleotide excision repair (NER) of DNA. TFB5 is required for stable recruitment of TFIIH to a promoter, but not for stability of TFIIH subunits (By similarity)
SGD closest match:S000007603TFB5RNA polymerase II transcription factor B subunit 5
CGD closest match:CAL0000181098TFB5RNA polymerase II transcription factor B subunit 5

Protein alignments

%idAln lengthE-value
MCA_05929_188.235%681.03e-40MCA_05929_1
A0A0J9X4I1_GEOCN82.609%696.55e-39Similar to Saccharomyces cerevisiae YDR079C-A TFB5 Component of the RNA polymerase II general transcription and DNA repair factor TFIIH OS=Geotrichum candidum GN=BN980_GECA01s09679g PE=4 SV=1
A0A1E3PHL8_9ASCO73.016%637.31e-32Component of the RNA polymerase II general transcription and DNA repair factor OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51511 PE=4 SV=1
UniRef50_A0A1L0BHK859.701%672.36e-25CIC11C00000000403 n=1 Tax=[Candida] intermedia TaxID=45354 RepID=A0A1L0BHK8_9ASCO
A0A060TID9_BLAAD60.000%654.86e-28ARAD1D45782p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D45782g PE=4 SV=1
TFB5_YEAST57.971%694.34e-26RNA polymerase II transcription factor B subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFB5 PE=1 SV=1
TFB5_YARLI55.882%689.58e-26RNA polymerase II transcription factor B subunit 5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TFB5 PE=3 SV=1
TFB5_CANAL55.072%691.32e-25RNA polymerase II transcription factor B subunit 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TFB5 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1439

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF06331 (Tfb5)
    2. SSF142897 (TFB5-like)
    3. SM01395 (Tbf5_2)

Protein sequence

>MIA_00693_1
MPSAIKGVLIECDPSIRALILHIDTKTHGVIIQELDDTHLLVDENRVEYIKSELNRLLAKNTFVPEDEK

GO term prediction

Biological Process

GO:0006289 nucleotide-excision repair
GO:0006355 regulation of transcription, DNA-templated

Molecular Function

None predicted.

Cellular Component

GO:0000439 core TFIIH complex