Protein

MIA_00656_1

Length
206 amino acids


Browser: contig01:1873363-1873984-

Protein function

EGGNOG:0PP82PGUG_04161mitochondrial 37S ribosomal protein MRPS12
SGD closest match:S000005319MRPS1237S ribosomal protein S12, mitochondrial
CGD closest match:CAL0000176693orf19.2438Putative mitochondrial 37S ribosomal protein MRPS12

Protein alignments

%idAln lengthE-value
A0A0J9X708_GEOCN88.060%1341.61e-82Similar to Saccharomyces cerevisiae YNR036C MRPS12 Mitochondrial protein OS=Geotrichum candidum GN=BN980_GECA04s02683g PE=4 SV=1
MCA_00456_187.023%1311.64e-80MCA_00456_1
A0A167D699_9ASCO72.519%1316.37e-65Putative mitochondrial 37S ribosomal protein MRPS12 OS=Sugiyamaella lignohabitans GN=MRPS12 PE=4 SV=1
A0A060T7T6_BLAAD73.438%1284.08e-61ARAD1C30272p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C30272g PE=3 SV=1
Q6CHZ8_YARLI71.212%1326.29e-59YALI0A03003p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A03003g PE=3 SV=1
UniRef50_G0WI0866.418%1346.20e-52Uncharacterized protein n=4 Tax=saccharomyceta TaxID=716545 RepID=G0WI08_NAUDC
A0A1E4TI45_9ASCO70.000%1302.56e-55Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_57677 PE=3 SV=1
Q5AA46_CANAL63.846%1303.60e-54Putative mitochondrial 37S ribosomal protein MRPS12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2438 PE=4 SV=1
RT12_YEAST66.412%1316.12e-5337S ribosomal protein S12, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS12 PE=1 SV=1
A0A1E3PR61_9ASCO77.885%1045.46e-5230S ribosomal protein S12 (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_6727 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 1.0000
Predicted cleavage: 132

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 206

Detailed signature matches

    1. PS00055 (RIBOSOMAL_S12)
    2. PR01034 (RIBOSOMALS12)
    3. PF00164 (Ribosom_S1...)
    1. cd03368 (Ribosomal_S12)
    1. SSF50249 (Nucleic a...)
Unintegrated signatures no IPR
Unintegrated signatures

Residue annotation

  1. S8 interaction sit...
  2. S17 interaction si...
  3. 16S rRNA interacti...
  4. streptomycin inter...
  5. 23S rRNA interacti...
  6. aminoacyl-tRNA int...

Protein sequence

>MIA_00656_1
MFSRLLVRSSIRSARVVSVRSLSSFTSFASPIICRPACRTPILSSSSSLPRLQSSVQQLTQSSASIISHAQQVRHATLNQ
ISRRGRFNTLLKRHKAKRSMTPDLNRSPFKKGVVLRVMILKPKKPNSANRKAARVRLSNGKVVTAYIPGEGHNAQEHSVV
TIRGGRTQDLPGVKYKCVRGLGDLAAVSNRRTSRSKYGAKKPAASN

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome
GO:0015935 small ribosomal subunit