Protein

MIA_00496_1

Length
305 amino acids


Browser: contig01:1431942-1432953-

Protein function

EGGNOG:0PGDSSEC13Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules. It also functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. Sec-13 is required for efficient mRNA export from the nucleus to the cytoplasm and for correct nuclear pore biogenesis and distribution (By similarity)
SGD closest match:S000004198SEC13Protein transport protein SEC13
CGD closest match:CAL0000177077SEC13Protein transport protein SEC13

Protein alignments

%idAln lengthE-value
A0A0J9XCJ0_GEOCN78.405%3013.59e-174Similar to Saccharomyces cerevisiae YLR208W SEC13 Component of the Nup84 nuclear pore sub-complex OS=Geotrichum candidum GN=BN980_GECA09s03541g PE=4 SV=1
A0A060T5V5_BLAAD77.741%3012.02e-170ARAD1B06622p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B06622g PE=4 SV=1
A0A167DBA9_9ASCO74.603%3151.08e-168GTPase-activating protein SEC13 OS=Sugiyamaella lignohabitans GN=SEC13 PE=4 SV=1
MCA_00145_177.333%3003.63e-166MCA_00145_1
SEC13_YARLI73.090%3013.15e-152Protein transport protein SEC13 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC13 PE=3 SV=1
A0A1E3PCC4_9ASCO72.787%3055.63e-148Protein transport protein SEC13 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84547 PE=4 SV=1
UniRef50_P5302466.887%3022.81e-143Protein transport protein SEC13 n=8 Tax=saccharomyceta TaxID=716545 RepID=SEC13_KOMPG
SEC13_YEAST67.550%3027.60e-145Protein transport protein SEC13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC13 PE=1 SV=1
SEC13_CANAL65.461%3045.95e-142Protein transport protein SEC13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC13 PE=1 SV=2
A0A1E4TKL8_9ASCO60.000%3005.85e-134Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_864 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4886
Predicted cleavage: 13

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Repeat
1 50 100 150 200 250 305

Detailed signature matches

    1. SSF50978 (WD40 repe...)
    2. PS50294 (WD_REPEATS...)
    1. PF00400 (WD40)
    2. PS50082 (WD_REPEATS_2)
    3. SM00320 (WD40_4)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MIA_00496_1
MVRGFVSIRNAHNDLIHDAVLDYYGKRLATASSDKTIKIFEIDGETQKLVDTLKKHEGPVWQVSWAHPKFGVILASASYD
GKVLIWREENRHWNNIHQHAVHKASVNSISWAPQEYGALLLCASSDGFISVVEFKDEGKYDHIIVSAHSYGVNAVSWAPP
SVSGSLIQSSGQQQLTQDSRRFVSGGSDNNVKIWKFDPAANTYVVETTLTGHTDWVRDVAWSPSVLSKSYIASASQDKTV
IIWTQEGDGPWTMKLLRSERFPDVVWRVSWSLSGNVLAVSGGDNKVTLWKENLKGEWESAGVIDE

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005515 protein binding

Cellular Component

None predicted.