Protein
MIA_00496_1
Length
305 amino acids
Browser: contig01:1431942-1432953-
Protein function
EGGNOG: | 0PGDS | SEC13 | Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules. It also functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. Sec-13 is required for efficient mRNA export from the nucleus to the cytoplasm and for correct nuclear pore biogenesis and distribution (By similarity) |
---|---|---|---|
SGD closest match: | S000004198 | SEC13 | Protein transport protein SEC13 |
CGD closest match: | CAL0000177077 | SEC13 | Protein transport protein SEC13 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XCJ0_GEOCN | 78.405% | 301 | 3.59e-174 | Similar to Saccharomyces cerevisiae YLR208W SEC13 Component of the Nup84 nuclear pore sub-complex OS=Geotrichum candidum GN=BN980_GECA09s03541g PE=4 SV=1 |
A0A060T5V5_BLAAD | 77.741% | 301 | 2.02e-170 | ARAD1B06622p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B06622g PE=4 SV=1 |
A0A167DBA9_9ASCO | 74.603% | 315 | 1.08e-168 | GTPase-activating protein SEC13 OS=Sugiyamaella lignohabitans GN=SEC13 PE=4 SV=1 |
MCA_00145_1 | 77.333% | 300 | 3.63e-166 | MCA_00145_1 |
SEC13_YARLI | 73.090% | 301 | 3.15e-152 | Protein transport protein SEC13 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC13 PE=3 SV=1 |
A0A1E3PCC4_9ASCO | 72.787% | 305 | 5.63e-148 | Protein transport protein SEC13 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84547 PE=4 SV=1 |
UniRef50_P53024 | 66.887% | 302 | 2.81e-143 | Protein transport protein SEC13 n=8 Tax=saccharomyceta TaxID=716545 RepID=SEC13_KOMPG |
SEC13_YEAST | 67.550% | 302 | 7.60e-145 | Protein transport protein SEC13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC13 PE=1 SV=1 |
SEC13_CANAL | 65.461% | 304 | 5.95e-142 | Protein transport protein SEC13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC13 PE=1 SV=2 |
A0A1E4TKL8_9ASCO | 60.000% | 300 | 5.85e-134 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_864 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.4886
Predicted cleavage: 13
Protein family membership
None predicted.
Domains and repeats
-
Domain
-
Repeat
1
50
100
150
200
250
305
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MIA_00496_1 MVRGFVSIRNAHNDLIHDAVLDYYGKRLATASSDKTIKIFEIDGETQKLVDTLKKHEGPVWQVSWAHPKFGVILASASYD GKVLIWREENRHWNNIHQHAVHKASVNSISWAPQEYGALLLCASSDGFISVVEFKDEGKYDHIIVSAHSYGVNAVSWAPP SVSGSLIQSSGQQQLTQDSRRFVSGGSDNNVKIWKFDPAANTYVVETTLTGHTDWVRDVAWSPSVLSKSYIASASQDKTV IIWTQEGDGPWTMKLLRSERFPDVVWRVSWSLSGNVLAVSGGDNKVTLWKENLKGEWESAGVIDE
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0005515 protein binding
Cellular Component
None predicted.