Protein
MIA_00466_1
Length
145 amino acids
Browser: contig01:1338193-1338809+
Protein function
EGGNOG: | 0PQP9 | PGUG_01975 | Protein of unknown function (DUF2416) |
---|---|---|---|
SGD closest match: | S000001349 | AIM19 | Altered inheritance of mitochondria protein 19, mitochondrial |
CGD closest match: | CAL0000192119 | CAALFM_CR06820WA | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_05787_1 | 56.780% | 118 | 2.13e-42 | MCA_05787_1 |
A0A0J9X8E6_GEOCN | 54.128% | 109 | 2.01e-39 | Uncharacterized protein OS=Geotrichum candidum GN=BN980_GECA05s02815g PE=4 SV=1 |
UniRef50_A0A0J9X8E6 | 54.128% | 109 | 4.10e-36 | Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X8E6_GEOCN |
A0A1E3PLU2_9ASCO | 42.857% | 119 | 1.31e-24 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82233 PE=4 SV=1 |
Q6C9X5_YARLI | 46.491% | 114 | 1.02e-21 | YALI0D07568p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D07568g PE=4 SV=1 |
AIM19_YEAST | 48.000% | 75 | 6.70e-17 | Altered inheritance of mitochondria protein 19, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM19 PE=1 SV=1 |
A0A1D8PTC9_CANAL | 42.683% | 82 | 3.44e-15 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR06820WA PE=4 SV=1 |
A0A060T9F6_BLAAD | 37.681% | 69 | 1.01e-07 | ARAD1D11506p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D11506g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7876
Predicted cleavage: 59
Protein family membership
- Altered inheritance of mitochondria protein 19 (IPR019419)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_00466_1 MSQSQNNPTNTNTTESTVVKTMWGQAVASAETPIPAWTFAVGLWLAFPKAAQNKAFRPGTKGIIGFSLTQILGGYMIYDN DLINGAGFSSVWSALYLLAYGRRAIKSVRPFPLGLATMAGFNAVYYGRHFFFPKNRASLPENGGI
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.