Protein

MIA_00411_1

Length
250 amino acids


Browser: contig01:1177942-1178807+

Protein function

EGGNOG:0PHVEPRE8The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)
SGD closest match:S000004557PRE8Proteasome subunit alpha type-2
CGD closest match:CAL0000197498PRE8Proteasome endopeptidase complex

Protein alignments

%idAln lengthE-value
MCA_00561_191.600%2501.86e-173MCA_00561_1
A0A1E3PS63_9ASCO85.200%2504.03e-163Proteasome endopeptidase complex OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_39668 PE=3 SV=1
A0A060TFJ4_BLAAD82.400%2501.14e-155Proteasome endopeptidase complex OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D15774g PE=3 SV=1
Q6C2N9_YARLI81.124%2499.97e-156Proteasome endopeptidase complex OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F06314g PE=3 SV=1
UniRef50_Q8X07779.200%2504.71e-143Probable proteasome subunit alpha type-2 n=40 Tax=Opisthokonta TaxID=33154 RepID=PSA2_NEUCR
PSA2_YEAST74.800%2501.71e-142Proteasome subunit alpha type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE8 PE=1 SV=1
A0A1D8PTY6_CANAL67.857%2523.92e-130Proteasome endopeptidase complex OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRE8 PE=3 SV=1
A0A167EI05_9ASCO84.181%1774.02e-113Proteasome endopeptidase complex OS=Sugiyamaella lignohabitans GN=PRE8 PE=3 SV=1
A0A1E4TEE2_9ASCO70.588%1193.04e-58Proteasome endopeptidase complex (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31160 PE=3 SV=1
A0A0J9X979_GEOCN36.239%2185.74e-44Proteasome endopeptidase complex OS=Geotrichum candidum GN=BN980_GECA05s06335g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2868

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 250

Detailed signature matches

    1. PF00227 (Proteasome)
    1. PS51475 (PROTEASOME...)
    1. SSF56235 (N-termina...)
    1. PS00388 (PROTEASOME...)
    2. PF10584 (Proteasome...)
    3. SM00948 (Proteasome...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd03750 (proteasome...)

Residue annotation

  1. alpha subunit inte...
  2. active site cd03750

Protein sequence

>MIA_00411_1
MADRYSFSLTTFSPSGKLTQIDYALQAVNKGVTSLGIKASNGIVLATEKKSSSHLINTDTLSKVDLITPDIGAVYSGMGP
DYRVLLGQARKLSHTAYKRIYNEYPPTRIMVQEVAKVMQEATQSGGVRPYGVSLLIAGWDQHFGYGLYQVDPSGAYFPWK
ATAIGKGSTSAKTFLEKRWNEELELEDAIHIALLTLKESIEGEMNGNTVEIAVVSEPADHLLGVRGVAGAEGPRFRKLSA
QEIDDRLDAL

GO term prediction

Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process
GO:0051603 proteolysis involved in cellular protein catabolic process

Molecular Function

GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity

Cellular Component

GO:0005839 proteasome core complex
GO:0019773 proteasome core complex, alpha-subunit complex