Protein
MIA_00391_1
Length
191 amino acids
Browser: contig01:1115020-1115596+
Protein function
| EGGNOG: | 0PQTS | FG05600.1 | Signal peptidase complex |
|---|---|---|---|
| SGD closest match: | S000004519 | SPC2 | Signal peptidase complex subunit SPC2 |
| CGD closest match: | CAL0000201813 | SPC2 | Signal peptidase complex subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_01841_1 | 44.886% | 176 | 1.70e-48 | MCA_01841_1 |
| A0A0J9X733_GEOCN | 44.910% | 167 | 1.13e-41 | Similar to Saccharomyces cerevisiae YML055W SPC2 Subunit of signal peptidase complex OS=Geotrichum candidum GN=BN980_GECA04s06522g PE=4 SV=1 |
| UniRef50_A0A0J9X733 | 44.910% | 167 | 2.31e-38 | Similar to Saccharomyces cerevisiae YML055W SPC2 Subunit of signal peptidase complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X733_GEOCN |
| A0A1E3PGQ1_9ASCO | 36.842% | 171 | 2.05e-30 | Microsomal signal peptidase 25 kDa subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_43736 PE=4 SV=1 |
| A0A060TAU2_BLAAD | 35.294% | 170 | 4.36e-22 | ARAD1D26488p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D26488g PE=4 SV=1 |
| Q6CGG8_YARLI | 35.766% | 137 | 2.32e-19 | YALI0A19492p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A19492g PE=4 SV=1 |
| Q59SJ1_CANAL | 28.758% | 153 | 7.99e-14 | Signal peptidase complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPC2 PE=4 SV=1 |
| A0A1E4TGT1_9ASCO | 27.607% | 163 | 5.74e-12 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2679 PE=4 SV=1 |
| SPC2_YEAST | 29.688% | 128 | 1.68e-10 | Signal peptidase complex subunit SPC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC2 PE=1 SV=1 |
| A0A167CRP6_9ASCO | 33.043% | 115 | 1.06e-09 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_263 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0644
Protein family membership
- Signal peptidase complex subunit 2 (IPR009582)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_00391_1 MTSIYGTQKEPINLYNISLLKSTSDDQVPLALKELGYATNNYLVDVRLALGYASVIVAALTAFYDHKVGFFAAKYPWTIL GLFIYIALNAAYTYWIWFVEAGIVYSGTKDALKISVATSKGSKKSKYDPVYDIKVTVSSDKTSAVITKSGTFDGWFATNG MIDYKKFATWISGAVSEAETKVSEKKSKKKN
GO term prediction
Biological Process
GO:0006465 signal peptide processing
Molecular Function
GO:0008233 peptidase activity
Cellular Component
GO:0005787 signal peptidase complex
GO:0016021 integral component of membrane