Protein

MIA_00386_1

Length
492 amino acids

Browser: contig01:1104552-1106082+

Protein function

EGGNOG:0PHKQMET7Catalyzes conversion of folates to polyglutamate derivatives allowing concentration of folate compounds in the cell and the intracellular retention of these cofactors, which are important substrates for most of the folate-dependent enzymes that are involved in one-carbon transfer reactions involved in purine, pyrimidine and amino acid synthesis (By similarity)
SGD closest match:S000005767MET7Folylpolyglutamate synthase
CGD closest match:CAL0000187593orf19.4516Folylpolyglutamate synthase

Protein alignments

%idAln lengthE-value
MCA_05022_164.859%4980.0MCA_05022_1
A0A0J9XGN4_GEOCN64.050%4840.0Folylpolyglutamate synthase OS=Geotrichum candidum GN=BN980_GECA15s03123g PE=3 SV=1
A0A060TAX6_BLAAD56.415%4910.0Folylpolyglutamate synthase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B04092g PE=3 SV=1
A0A167CK84_9ASCO58.084%5010.0Folylpolyglutamate synthase OS=Sugiyamaella lignohabitans GN=MET7 PE=3 SV=1
Q6C4Q7_YARLI56.619%4911.36e-179Folylpolyglutamate synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E24497g PE=3 SV=1
UniRef50_Q6C4Q756.619%4913.15e-176Folylpolyglutamate synthase n=2 Tax=Yarrowia lipolytica TaxID=4952 RepID=Q6C4Q7_YARLI
FOLE_YEAST51.646%4861.16e-170Folylpolyglutamate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET7 PE=1 SV=1
A0A1E3PL71_9ASCO53.425%5111.48e-167Folylpolyglutamate synthase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82097 PE=3 SV=1
A0A1D8PH56_CANAL46.733%5051.14e-145Folylpolyglutamate synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4516 PE=3 SV=1
A0A1E4TFG1_9ASCO47.241%4533.40e-137Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2165 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0791

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 450 492

Detailed signature matches

  1. Family IPR001645
    Folylpolyglutamate synthetase
    1. TIGR01499
  2. Family IPR023600
    Folylpolyglutamate synthase, eukaryota
    1. PIRSF038895 (FPGS)
  3. Domain IPR013221
    Mur ligase, central
    1. G3DSA:3.40.11...
    2. SSF53623 (MurD-like...)
  4. Domain IPR004101
    Mur ligase, C-terminal
    1. SSF53244 (MurD-like...)
  5. SITE IPR018109
    Folylpolyglutamate synthetase, conserved site
    1. PS01012 (FOLYLPOLYG...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.90.19...

Protein sequence

>MIA_00386_1
MRAMPDKKTYLNAIKALNNLQSNYATIQAAQAAGPQLDKAIPHMIEWARRAGYSPTDLDKLNVIHVTGTKGKGSVCAFVQ
AILAQYPAATGNKTGLYTSPHLKSVRERIRINGEPISKDLFTKYFFELFDRLSSSSSDLAVFPEFSPGIKPNYFRFLTLL
SFHVFLSEGVKCAIYEVGIGGEYDSTNIVPHPVATGVTSLGIDHTNMLGNTIEEIAWNKGGIYKSSALALSIPQPPGALK
VLEDRAREKNTQFVVLDPAASPVRALKLGLPARFQYVNATLAVGLAKQLLLKSPSSPQLDIDVDPNSPLPEKFVKGLETA
SWPGRCQTLPDGPNLTWYLDGAHTQESITETGLWFKTVADPNADHRVLIFNQQKRDAGALADTLHKAMGPDAPSFDHALF
CTNVTWASGTYSAELASINTSAVAVDALTVQKGLADSWAKIDSSSHRHVFSSIQEAVEFVKSLDGKVQVLVTGSLHLVGG
LLAVFDGPDEEE

GO term prediction

Biological Process

GO:0009058 biosynthetic process
GO:0009396 folic acid-containing compound biosynthetic process

Molecular Function

GO:0004326 tetrahydrofolylpolyglutamate synthase activity
GO:0005524 ATP binding
GO:0016874 ligase activity

Cellular Component

None predicted.