Protein

MIA_00372_1

Length
129 amino acids


Browser: contig01:1067192-1067632+

Protein function

EGGNOG:0PSM6PAM18mitochondrial import inner membrane translocase subunit tim14
SGD closest match:S000003998PAM18Mitochondrial import inner membrane translocase subunit TIM14
CGD closest match:CAL0000200634PAM18Mitochondrial import inner membrane translocase subunit TIM14

Protein alignments

%idAln lengthE-value
A0A0J9XGD8_GEOCN50.769%1302.21e-41Similar to Saccharomyces cerevisiae YNL328C MDJ2 Constituent of the mitochondrial import motor associated with the presequence translocase OS=Geotrichum candidum GN=BN980_GECA16s00411g PE=4 SV=1
UniRef50_A0A0J9XGD850.769%1304.53e-38Similar to Saccharomyces cerevisiae YNL328C MDJ2 Constituent of the mitochondrial import motor associated with the presequence translocase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XGD8_GEOCN
A0A060T2A1_BLAAD49.167%1201.46e-35ARAD1C27324p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C27324g PE=4 SV=1
A0A1E4TC34_9ASCO62.121%661.75e-24Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_18681 PE=4 SV=1
TIM14_YEAST56.410%781.99e-23Mitochondrial import inner membrane translocase subunit TIM14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAM18 PE=1 SV=1
A0A1E3PFP2_9ASCO55.882%689.20e-24J-protein co-chaperone of the mitochondrial import motor OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53352 PE=4 SV=1
TIM14_CANAL55.882%681.53e-21Mitochondrial import inner membrane translocase subunit TIM14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAM18 PE=3 SV=1
TIM14_YARLI57.576%661.45e-21Mitochondrial import inner membrane translocase subunit TIM14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAM18 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8034
Predicted cleavage: 33

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 129

Detailed signature matches

    1. SM00271 (dnaj_3)
    2. PS50076 (DNAJ_2)
    3. SSF46565 (Chaperone...)
    4. cd06257 (DnaJ)
Unintegrated signatures no IPR
Unintegrated signatures

Residue annotation

  1. HSP70 interaction ...

Protein sequence

>MIA_00372_1
MVTRQVWPIVASLVGALAFTSARAAFRAYGRLKTMPPEAFYGNFNSYGGKSAHDKYNRPFYEGGFDAQMTVSEALDILGM
TGEAELTKRAIRSNHRKVMLQNHPDKGGSPYLATKINEAREVLDKVATR

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.