Protein

MIA_00347_1

Length
773 amino acids

Browser: contig01:996640-998962+

Protein function

EGGNOG:0PJ0RPGUG_05823One of the essential components for the initiation of protein synthesis. Protects formylmethionyl-tRNA from spontaneous hydrolysis and promotes its binding to the 30S ribosomal subunits. Also involved in the hydrolysis of GTP during the formation of the 70S ribosomal complex (By similarity)
SGD closest match:S000005383IFM1Translation initiation factor IF-2, mitochondrial
CGD closest match:CAL0000198780IFM1Translation initiation factor 2

Protein alignments

%idAln lengthE-value
MCA_00423_170.458%6330.0MCA_00423_1
A0A0J9XDL5_GEOCN65.931%6340.0Similar to Saccharomyces cerevisiae YOL023W IFM1 Mitochondrial translation initiation factor 2 OS=Geotrichum candidum GN=BN980_GECA09s01935g PE=3 SV=1
A0A167FBX8_9ASCO60.160%6250.0Translation initiation factor 2 OS=Sugiyamaella lignohabitans GN=IFM1 PE=3 SV=1
A0A060T7N8_BLAAD55.521%6430.0ARAD1B21142p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B21142g PE=3 SV=1
UniRef50_A0A061B61852.698%6300.0CYFA0S18e01002g1_1 n=9 Tax=Saccharomycetales TaxID=4892 RepID=A0A061B618_CYBFA
Q5A5B3_CANAL51.043%6230.0Translation initiation factor 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IFM1 PE=3 SV=1
Q6CDQ9_YARLI50.080%6250.0YALI0B21978p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B21978g PE=3 SV=1
A0A1E4TET0_9ASCO45.972%6331.01e-180Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2008 PE=3 SV=1
IF2M_YEAST42.857%6373.45e-156Translation initiation factor IF-2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IFM1 PE=1 SV=2
A0A1E3PG77_9ASCO50.000%3948.47e-117Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83897 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9664
Predicted cleavage: 45

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 100 200 300 400 500 600 700 773

Detailed signature matches

  1. Family IPR000178
    Translation initiation factor aIF-2, bacterial-like
    1. MF_00100_B (IF_2_B)
  2. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  3. Domain IPR005225
    Small GTP-binding protein domain
    1. TIGR00231
  4. Domain IPR000795
    Transcription factor, GTP-binding domain
    1. PS51722 (G_TR_2)
    2. PF00009 (GTP_EFTU)
  5. Domain IPR009000
    Translation protein, beta-barrel domain
    1. SSF50447 (Translati...)
  6. Domain IPR023115
    Translation initiation factor IF- 2, domain 3
    1. SSF52156 (Initiatio...)
    2. PF11987 (IF-2)
    3. G3DSA:3.40.50...
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:2.40.30.10
  3. G3DSA:3.40.50...
  4. cd01887 (IF2_eIF5B)
  5. cd03692 (mtIF2_IVc)
  6. cd03702 (IF2_mtIF2_II)
  7. mobidb-lite (disord...)

Residue annotation

  1. G1 box cd01887
  2. putative GEF inter...
  3. GTP/Mg2+ binding s...
  4. Switch I region cd...
  5. G2 box cd01887
  6. G3 box cd01887
  7. Switch II region c...
  8. G4 box cd01887
  9. G5 box cd01887
  10. putative rRNA bind...
  11. tRNA binding site ...

Protein sequence

>MIA_00347_1
MLSLLRVHNRYAVSALRFQQLGVRLYSIKSPRVKRPGAFTSSRQKVPPTPAPPPPPPPSVASTIAQAPSESPEVKETKAT
LVKNNSQKNSLSKPPAEKGQKTSPKSEDKRKNNNSSNKEHNKRNNDQQTLKNNKPKPNHPPKKKIVKLSQKKTVMIPKSI
TLANFSHVVNTKYSQLVHLMTEMGFENLRHDYILSESDAKMIAEELGFVPVIDDSLGLDIYPAPPPTTEELIKMPFRPPI
VTIMGHVDHGKTTILDYLRKSSVAAGEHGGITQHIGAFSVKLSSNKEICFLDTPGHAAFLNMRERGANVTDIVVLVVAAD
DSVMPQTKEAIKHAQNAAVPMIVAINKCDKPDANPKKVVEDLSANGVDVEDYGGETQTICVSGKTGKGIDDLEDAIITLS
EMLEIKAPKIGNAEGYVIESQVKKGQGSSATVLVRRGTLKVGSFVVAGQTWAKVRSMRDSSGKAVKQAGPGTPVEVTGWK
ELPVAGDEMLQAKNENQAKTVAETRIERAKMEKEADEINVLNEKRQKLHEEQEKELKRQERLKMGLSAEVESKFVDTSKS
DEADGPIIVPFIIKADVSGSAEAVADSIQGLGNGEVQSSVLYKGVGPVTDTDLTRAETAGAVILTFNVATDRDISHKAQS
KHIKIAEHKIIYKLLEEVTEELASKLEPEIKHKVLGEASIKEIFNITLKRSKNMQIAGTRVTNGLLARNAKVKVLRDNEV
IYVGNFSSLKHFKDEIETAKKDTDCGVAFTNWDKFEVGDVIQTFEEIVIPRHF

GO term prediction

Biological Process

GO:0006413 translational initiation

Molecular Function

GO:0003743 translation initiation factor activity
GO:0003924 GTPase activity
GO:0005525 GTP binding

Cellular Component

GO:0005622 intracellular