Protein

MIA_00328_1

Length
187 amino acids

Browser: contig01:953351-953915-

Protein function

EGGNOG:0PMXFFG09866.160S ribosomal protein L18
SGD closest match:S000005480RPL18A60S ribosomal protein L18-A
CGD closest match:CAL0000188970RPL18Ribosomal 60S subunit protein L18A

Protein alignments

%idAln lengthE-value
MCA_01222_179.144%1871.13e-85MCA_01222_1
A0A1E3PNA2_9ASCO64.706%1872.77e-72Putative ribosomal protein of the large subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46099 PE=4 SV=1
A0A0J9YHI2_GEOCN67.380%1874.45e-70Similar to Saccharomyces cerevisiae YNL301C RPL18B Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA01s04872g PE=4 SV=1
A0A167F1S7_9ASCO68.984%1875.16e-69Ribosomal 60S subunit protein L18A OS=Sugiyamaella lignohabitans GN=RPL18A PE=4 SV=1
UniRef50_A0A1A0HHZ569.149%1887.69e-6360S ribosomal protein L18 n=4 Tax=Saccharomycetales TaxID=4892 RepID=A0A1A0HHZ5_9ASCO
A0A1D8PK43_CANAL65.241%1875.83e-66Ribosomal 60S subunit protein L18A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL18 PE=4 SV=1
RL18A_YEAST65.241%1873.74e-6560S ribosomal protein L18-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL18A PE=1 SV=1
Q6CFA4_YARLI70.213%1887.99e-60YALI0B08866p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B08866g PE=4 SV=1
A0A060TIS7_BLAAD68.085%1888.44e-58ARAD1D40568p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D40568g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6749
Predicted cleavage: 44

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 187

Detailed signature matches

  1. Domain IPR021131
    Ribosomal protein L18e/L15P
    1. SSF52080 (Ribosomal...)
    2. PF17135 (Ribosomal_L18)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.100.1...
  2. mobidb-lite (disord...)

Protein sequence

>MIA_00328_1
MGIDHTKKQHIRNSQRQAPKSANPQLALLVSLYRVLARRTESEINKTILQSLYLSKTNRPPVSTADIAAELKKGSIAAGK
IVVVVGTVTDDARLIEVPKVTVAALRFTATARARIVKAGGEALTLDQLARRTPTGEDAVLVKGDRARRQAVRHFGFGPNQ
KKAPRVLSKGRKFERARGRRHSRAFKV

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.