Protein
MIA_00242_1
Length
131 amino acids
Browser: contig01:679346-679791-
Protein function
EGGNOG: | 0PQ8U | ACN9 | acetate non-utilizing protein 9 |
---|---|---|---|
SGD closest match: | S000002919 | SDH7 | Succinate dehydrogenase assembly factor 3, mitochondrial |
CGD closest match: | CAL0000193085 | SDH7 | Succinate dehydrogenase assembly factor 3, mitochondrial |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_02772_1 | 79.231% | 130 | 1.58e-61 | MCA_02772_1 |
A0A0J9X9Z1_GEOCN | 75.385% | 130 | 1.56e-55 | Similar to Saccharomyces cerevisiae YDR511W ACN9 Protein of the mitochondrial intermembrane space, required for acetate utilization and gluconeogenesis OS=Geotrichum candidum GN=BN980_GECA06s04498g PE=4 SV=1 |
Q6CCG6_YARLI | 71.910% | 89 | 1.22e-41 | YALI0C09548p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C09548g PE=4 SV=1 |
A0A1E4TBC8_9ASCO | 65.517% | 87 | 3.49e-39 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_133113 PE=4 SV=1 |
UniRef50_M2YJ31 | 60.000% | 90 | 1.31e-32 | Uncharacterized protein (Fragment) n=7 Tax=Fungi TaxID=4751 RepID=M2YJ31_PSEFD |
A0A060T7N7_BLAAD | 57.724% | 123 | 3.31e-35 | ARAD1C23430p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C23430g PE=4 SV=1 |
SDHF3_CANAL | 63.750% | 80 | 3.13e-32 | Succinate dehydrogenase assembly factor 3, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SDH7 PE=3 SV=1 |
A0A1E3PTJ6_9ASCO | 55.682% | 88 | 5.09e-30 | Acetate non-utilizing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81509 PE=4 SV=1 |
SDHF3_YEAST | 53.750% | 80 | 2.19e-26 | Succinate dehydrogenase assembly factor 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH7 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9966
Predicted cleavage: 45
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
PF13233 (Complex1_L...)
Protein sequence
>MIA_00242_1 MKLTLVLNATRRHIKPVSPILPPLPLFRRVLRAHRKLPPDARYLGDEYVKSEFRAHKNIDNPLYIVGFLTQWQKYAELIE GDTWKQDKLDVEKLSKMSDEQIVQLYELMQATKNEPSEYGDILKPLDKKKD
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.