Protein
MIA_00076_1
Length
158 amino acids
Browser: contig01:190966-191571-
Protein function
| EGGNOG: | 0PQIS | Protein of Unknown function (DUF1690) | |
|---|---|---|---|
| SGD closest match: | S000001907 | MIC19 | MICOS complex subunit MIC19 |
| CGD closest match: | CAL0000194733 | orf19.6062.3 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02511_1 | 46.250% | 160 | 8.64e-42 | MCA_02511_1 |
| A0A0J9X974_GEOCN | 43.226% | 155 | 5.17e-35 | Similar to Saccharomyces cerevisiae YFR011C AIM13 Mitochondrial protein peripheral to the inner membrane OS=Geotrichum candidum GN=BN980_GECA05s06280g PE=4 SV=1 |
| UniRef50_A0A0J9X974 | 43.226% | 155 | 1.06e-31 | Similar to Saccharomyces cerevisiae YFR011C AIM13 Mitochondrial protein peripheral to the inner membrane n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X974_GEOCN |
| A0A167EML8_9ASCO | 43.046% | 151 | 2.84e-32 | Mic19p OS=Sugiyamaella lignohabitans GN=MIC19 PE=4 SV=1 |
| Q6CAG7_YARLI | 38.411% | 151 | 1.96e-28 | YALI0D02893p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D02893g PE=4 SV=2 |
| A0A1E3PNW9_9ASCO | 39.610% | 154 | 1.09e-25 | DUF1690-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45332 PE=4 SV=1 |
| A0A1D8PC73_CANAL | 36.601% | 153 | 3.00e-22 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6062.3 PE=4 SV=1 |
| A0A060TCK3_BLAAD | 35.294% | 153 | 1.82e-20 | ARAD1D39820p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D39820g PE=4 SV=1 |
| A0A1E4TJT2_9ASCO | 29.932% | 147 | 3.68e-15 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_514 PE=4 SV=1 |
| MIC19_YEAST | 27.439% | 164 | 6.83e-11 | MICOS complex subunit MIC19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIC19 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0996
Protein family membership
- Protein of unknown function DUF1690 (IPR012471)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_00076_1 MGQASSTEKQSSTKVFLPSTPTQFSAGLISKMDTSIESDYTRSQYTEKYIQDRVAQELEKIEQDAAAALKKAFEESSKES PESASSSSSISSADLRAQVKQLSDKLDATRTRHSLDDDTTAVRNAVAKCLADNSTKPLKCYDEYLAFKQKVAEYEQKL
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.