Protein

MIA_00042_1

Length
183 amino acids

Browser: contig01:97760-98312-

Protein function

EGGNOG:0PJZERHB1rheb small monomeric GTPase
SGD closest match:S000000622RHB1Rheb-like protein RHB1
CGD closest match:CAL0000173935RHB1Putative GTPase

Protein alignments

%idAln lengthE-value
A0A0J9XHW6_GEOCN81.967%1832.07e-112Similar to Saccharomyces cerevisiae YCR027C RHB1 Putative Rheb-related GTPase involved in regulating canavanine resistance and arginine uptake, member of the Ras superfamily of G-proteins OS=Geotrichum candidum GN=BN980_GECA17s02155g PE=4 SV=1
MCA_00325_181.967%1837.24e-110MCA_00325_1
A0A060T4A2_BLAAD73.743%1792.48e-98ARAD1C43208p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C43208g PE=4 SV=1
A0A167FID0_9ASCO71.038%1832.83e-94Putative GTPase RHB1 OS=Sugiyamaella lignohabitans GN=RHB1 PE=4 SV=1
A0A1E4TJT1_9ASCO68.478%1844.74e-93Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30256 PE=4 SV=1
Q6C400_YARLI66.484%1826.46e-92YALI0E30943p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E30943g PE=4 SV=1
UniRef50_O9436362.295%1832.66e-79GTP-binding protein rhb1 n=47 Tax=Fungi TaxID=4751 RepID=RHB1_SCHPO
A0A1E3PF62_9ASCO63.043%1843.99e-82GTP-binding protein rhb1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84075 PE=4 SV=1
Q5ANA9_CANAL57.778%1802.71e-78Putative GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RHB1 PE=4 SV=1
RHEB_YEAST45.078%1938.86e-53Rheb-like protein RHB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHB1 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2681
Predicted cleavage: 18

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 183

Detailed signature matches

  1. Family IPR001806
    Small GTPase superfamily
    1. PF00071 (Ras)
  2. Family IPR020849
    Small GTPase superfamily, Ras type
    1. PS51421 (RAS)
  3. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  4. Domain IPR005225
    Small GTP-binding protein domain
    1. TIGR00231
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.50...
  2. PR00449 (RASTRNSFRMNG)
  3. SM00173 (ras_sub_4)
  4. SM00174 (rho_sub_3)
  5. SM00175 (rab_sub_5)
  6. cd04137 (RheB)

Residue annotation

  1. G1 box cd04137
  2. putative GDI inter...
  3. GTP/Mg2+ binding s...
  4. putative GEF inter...
  5. Switch I region cd...
  6. putative effector ...
  7. G2 box cd04137
  8. G3 box cd04137
  9. Switch II region c...
  10. G4 box cd04137
  11. G5 box cd04137
  12. putative lipid mod...

Protein sequence

>MIA_00042_1
MVPPQRARKIAIVGASAVGKSSVTVQFVDEHFVESYYPTIENQFFKPIKYKGVEYTTEIIDTAGQDEFSIMNQKHLIGIH
GYMLVYSIASRASFEMISIIRDKILNATGAETLPMVVVGNKTDLESQRQVPAQEGKALADSFGAAFVETSAKDKVNVDKA
FELLISQIDSTSAENKDKGCVIS

GO term prediction

Biological Process

GO:0007165 signal transduction

Molecular Function

GO:0003924 GTPase activity
GO:0005525 GTP binding

Cellular Component

GO:0016020 membrane