Protein

MIA_00015_1

Length
220 amino acids

Browser: contig01:37079-37742-

Protein function

EGGNOG:0PGDVFG10276.1nadh-ubiquinone oxidoreductase
CGD closest match:CAL0000184766FESUR1Fesur1p

Protein alignments

%idAln lengthE-value
MCA_05603_198.204%1675.62e-112MCA_05603_1
A0A167DCB9_9ASCO95.808%1679.83e-110Putative mitochondrial Complex I, NUKM_20kd subunit OS=Sugiyamaella lignohabitans GN=AWJ20_1021 PE=3 SV=1
A0A0J9YH70_GEOCN94.012%1677.72e-108NUKM subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA01s00098g PE=3 SV=1
A0A060SVV1_BLAAD91.018%1679.46e-106ARAD1A00396p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A00396g PE=3 SV=1
A0A1E4TGW7_9ASCO91.018%1675.18e-103Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31803 PE=3 SV=1
UniRef50_J3NG9289.024%1644.96e-96NADH-ubiquinone oxidoreductase 19.3 kDa subunit n=10 Tax=leotiomyceta TaxID=716546 RepID=J3NG92_GAGT3
Q5ADP7_CANAL84.940%1662.74e-97Fesur1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FESUR1 PE=3 SV=1
Q6C2Q1_YARLI93.846%1309.11e-78YALI0F06050p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F06050g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8804
Predicted cleavage: 41

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 220

Detailed signature matches

  1. Family IPR006138
    NADH-ubiquinone oxidoreductase, 20 Kd subunit
    1. PS01150 (COMPLEX1_20K)
    2. MF_01356 (NDH1_NuoB)
    3. TIGR01957
  2. Domain IPR006137
    NADH:ubiquinone oxidoreductase-like, 20kDa subunit
    1. PF01058 (Oxidored_q6)
    2. G3DSA:3.40.50...
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. SSF56770 (HydA/Nqo6...)

Protein sequence

>MIA_00015_1
MLSRSLAPIARASLPSSSSLVLRTATKASPTLIALSSTRSASSLSKHTSSLPTDYPLASQQKPSSVVDYALTTLDAIANW
ARQGSFWPVTFGLACCAVEMMHVSAPRYDQDRLGIIFRASPRQSDIMIVAGTLTNKMAPALRQVYDQMPEPRWVISMGSC
ANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTSEALMYGVFQLQKKMRNQKITRMWYRK

GO term prediction

Biological Process

GO:0055114 oxidation-reduction process

Molecular Function

GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0048038 quinone binding
GO:0051536 iron-sulfur cluster binding
GO:0051539 4 iron, 4 sulfur cluster binding

Cellular Component

None predicted.