Protein

MCA_mt_19351080

Length
249 amino acids

Gene name: cox2

Description: Cytochrome c oxidase subunit 2

Browser: mtDNA:41248-41998+

RNA-seq: read pairs 0, FPKM 0.0, percentile rank 0.8% (100% = highest expression)

Protein function

Annotation:cox2Cytochrome c oxidase subunit 2
KEGG:K02261COX2 cytochrome c oxidase subunit 2
EGGNOG:0PMT7COX2Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. Subunit 2 transfers the electrons from cytochrome c via its binuclear copper A center to the bimetallic center of the catalytic subunit 1 (By similarity)
SGD closest match:S000007281COX2Cytochrome c oxidase subunit 2
CGD closest match:CAL0000186073COX2Cytochrome c oxidase subunit 2

Protein alignments

%idAln lengthE-value
MIA_mt_1935095887.50%2403e-160MIA_mt_19350958
A0A0A1I5X5_GEOCN82.20%2362e-150Cytochrome c oxidase subunit 2 OS=Geotrichum candidum GN=cox2 PE=3 SV=1
A0A060RCP3_BLAAD72.27%2383e-137Cytochrome c oxidase subunit 2 OS=Blastobotrys adeninivorans GN=cox2 PE=3 SV=1
COX2_YEAST68.78%2371e-131Cytochrome c oxidase subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX2 PE=1 SV=1
UniRef50_P0041068.78%2373e-128Cytochrome c oxidase subunit 2 n=196 Tax=Opisthokonta TaxID=33154 RepID=COX2_YEAST
COX2_YARLI60.92%2383e-118Cytochrome c oxidase subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COX2 PE=3 SV=1
COX2_CANAL60.76%2374e-114Cytochrome c oxidase subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX2 PE=3 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0763

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 50 100 150 200 249

Detailed signature matches

  1. Domain IPR011759
    Cytochrome C oxidase subunit II, transmembrane domain
    1. PS50999 (COX2_TM)
    2. PF02790 (COX2_TM)
    3. SSF81464 (Cytochrom...)
  2. Domain IPR014222
    Cytochrome c oxidase, subunit II
    1. TIGR02866
  3. Domain IPR008972
    Cupredoxin
    1. G3DSA:2.60.40...
    2. SSF49503 (Cupredoxins)
  4. Domain IPR002429
    Cytochrome c oxidase subunit II-like C-terminal
    1. PS50857 (COX2_CUA)
    2. PF00116 (COX2)
  5. Domain IPR034210
    Cytochrome c oxidase subunit 2, C-terminal
    1. cd13912 (CcO_II_C)
  6. SITE IPR001505
    Copper centre Cu(A)
    1. PS00078 (COX2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. G3DSA:1.10.28...
  3. NON_CYTOPLASM... (N...)
  4. PR01166 (CYCOXIDASEII)
  5. TMhelix
  6. TRANSMEMBRANE (Tran...)

Residue annotation

  1. subunit II/VIb int...
  2. subunit II/VIc int...
  3. CuA binding site c...
  4. subunit I/II inter...
  5. subunit II/IV inte...

Protein sequence

>MCA_mt_19351080
MSLMMNNSLMFNDVPKPWGMFFQDSATAMAEGMMEVHDTMMFYMMMVLTLVTYILYSMVTTFSKNPMSYKYMMHGTTLEV
VWTMFPAVMLMLIALPSFVLLYLSDEVMDPAMTVKAMGYQWYWVYEYSDFINESGETIQLESYIMPDELLEEGQLHALDV
DNRLVLPIDTHIRMVVTANDVIHDFFVPSLGMKIDACPGRLNQLSAMIQREGVFYGQCSELCGTAHAYMPIVMEAVTLPK
YLEWLNEQE

GO term prediction

Biological Process

GO:0022900 electron transport chain

Molecular Function

GO:0004129 cytochrome-c oxidase activity
GO:0005507 copper ion binding
GO:0016491 oxidoreductase activity

Cellular Component

GO:0016020 membrane
GO:0016021 integral component of membrane