Protein

MCA_mt_19351078

Length
343 amino acids

Gene name: nad1

Description: NADH-ubiquinone oxidoreductase subunit 1

Browser: mtDNA:39849-40992+

RNA-seq: read pairs 0, FPKM 0.0, percentile rank 0.8% (100% = highest expression)

Protein function

Annotation:nad1NADH-ubiquinone oxidoreductase subunit 1
KEGG:K03878ND1 NADH-ubiquinone oxidoreductase chain 1 [EC:1.6.5.3]
EGGNOG:0PQPENADH dehydrogenase
CGD closest match:CAL0000201667NAD1NADH-ubiquinone oxidoreductase chain 1

Protein alignments

%idAln lengthE-value
MIA_mt_1935095688.63%3430.0MIA_mt_19350956
UniRef50_K9L3F482.51%3430.0NADH-ubiquinone oxidoreductase chain 1 n=5 Tax=Dikarya TaxID=451864 RepID=K9L3F4_MAGMU
A0A0A1I5E5_GEOCN81.48%3510.0NADH-ubiquinone oxidoreductase chain 1 OS=Geotrichum candidum GN=ND1 PE=3 SV=1
A0A060REV9_BLAAD68.69%3132e-145NADH-ubiquinone oxidoreductase chain 1 OS=Blastobotrys adeninivorans GN=nd1 PE=3 SV=1
NU1M_YARLI66.08%3422e-143NADH-ubiquinone oxidoreductase chain 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ND1 PE=1 SV=1
NU1M_CANAL48.08%3124e-93NADH-ubiquinone oxidoreductase chain 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NAD1 PE=3 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0758

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR001694
    NADH:ubiquinone oxidoreductase, subunit 1/F420H2 oxidoreductase subunit H
    1. MF_01350 (NDH1_NuoH)
    2. PF00146 (NADHdh)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. SIGNAL_PEPTIDE (Sig...)
  4. SIGNAL_PEPTID... (S...)
  5. SIGNAL_PEPTID... (S...)
  6. SIGNAL_PEPTID... (S...)
  7. TMhelix
  8. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_mt_19351078
MMLDIMEILMFLVCVLFSVAYLTVAERKTLGYLQRRLGPNAMGWYGLTQAFADAVKLLIKEMILPKESNKYMLIMSPLMT
LMTALMGWVVMPLGPAMTLGDMENGILFSLAMGSLGVFGVTLSGWSSNSKYSFMGSIRSTAQLMSYELVLTTIYMICMMF
VSTLNMTTYMETQRMMWLFMPLFPLFMMFFMSTMAETNRPPFDTVEAESELVAGFFTEYSGSPFVFFFLAEYSNLMLMCA
STTMLFLGGYLNFEWINNIILYPFNFMQYSFIYNFIEGSLYGMALAIKLMMLMFTFIWVRASFPRFTYDNLINLCWLRFL
PLLFAFAMLMPCILYIFNAFSFI

GO term prediction

Biological Process

GO:0055114 oxidation-reduction process

Molecular Function

None predicted.

Cellular Component

GO:0016020 membrane