Protein

MCA_mt_19351076

Length
376 amino acids


Description: putative intron-encoded homing endonuclease with two LAGLIDADG_1 motifs

Browser: mtDNA:28088-29342+

RNA-seq: read pairs 0, FPKM 0.0, percentile rank 0.8% (100% = highest expression)

Protein function

Annotation:putative intron-encoded homing endonuclease with two LAGLIDADG_1 motifs
EGGNOG:0QDTXCytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B (By similarity)
SGD closest match:S000007263AI3Intron-encoded DNA endonuclease aI3

Protein alignments

%idAln lengthE-value
UniRef50_A0A023UMY7100.00%3760.0Uncharacterized protein (Fragment) n=3 Tax=Magnusiomyces TaxID=1095182 RepID=A0A023UMY7_9ASCO
Q9B6E3_YARLI40.79%3539e-71COX1-i2 protein, alternatively spliced OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=cox1 PE=4 SV=1
SCE3_YEAST42.73%3372e-70Intron-encoded DNA endonuclease aI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AI3 PE=1 SV=3
MIA_mt_1935097022.39%3262e-06MIA_mt_19350970

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 376

Detailed signature matches

    1. SSF55608 (Homing en...)
    1. PF00961 (LAGLIDADG_1)

Protein sequence

>MCA_mt_19351076
NPLNTFINFITTNPKPLVNLINNNDVMNKYNNSMMDIEHNNIMNIPPLEDPSINYDYLRPYLAGLIEGDGTMWVGTGKNI
STMPKVNMVFNMKDKPLAEYLLQITKCGTLTKKSSGNYMMWQMQNFREVYHMLSLINGYMRTPKHEALMRALVWYNNYIN
KYKNIDTNSKLKNWESVNTPQSINLMKNLDVFELLSRDTSPLNSNSWLAGITDANGNFSISLYKKKRINLYYRLELKQNY
HRPLDINIKNDMETLNSIINKGESYLNMMSSIASFFNTNLYSRSRNMKLKDEYKLYSSYIVMVTNKEGLKLVKQYFDKYP
LLSSKYLDYKDWAYIVKIIESKGQTSESYKLAEQIRTNYNSTRHKFKWDHLKLFKK

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0004519 endonuclease activity

Cellular Component

None predicted.