MCA_mt_19351069
Gene name: cox1
Description: Cytochrome c oxidase subunit 1
Browser: mtDNA:27788-37910+
RNA-seq: read pairs 2, FPKM 0.0, percentile rank 2.3% (100% = highest expression)
Protein function
| Annotation: | cox1 | Cytochrome c oxidase subunit 1 | |
|---|---|---|---|
| KEGG: | K02256 | COX1 | cytochrome c oxidase subunit 1 [EC:1.9.3.1] |
| EGGNOG: | 0PJIY | COX1 | Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1- 3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B |
| SGD closest match: | S000007260 | COX1 | Cytochrome c oxidase subunit 1 |
| CGD closest match: | CAL0000187344 | COX1 | Cytochrome c oxidase subunit 1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_mt_19350966 | 89.50% | 543 | 0.0 | MIA_mt_19350966 |
| A0A0A1I5J3_GEOCN | 88.08% | 537 | 0.0 | Cytochrome c oxidase subunit 1 OS=Geotrichum candidum GN=cox1 PE=3 SV=1 |
| A0A060RF32_BLAAD | 74.81% | 536 | 0.0 | Cytochrome c oxidase subunit 1 OS=Blastobotrys adeninivorans GN=cox1 PE=3 SV=1 |
| COX1_YEAST | 66.54% | 535 | 0.0 | Cytochrome c oxidase subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX1 PE=3 SV=2 |
| UniRef50_P00401 | 66.54% | 535 | 0.0 | Cytochrome c oxidase subunit 1 n=119 Tax=cellular organisms TaxID=131567 RepID=COX1_YEAST |
| COX1_YARLI | 63.87% | 537 | 0.0 | Cytochrome c oxidase subunit 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COX1 PE=3 SV=1 |
| COX1_CANAL | 59.13% | 531 | 0.0 | Cytochrome c oxidase subunit 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX1 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1343
Predicted cleavage: 183
Protein family membership
- Cytochrome c oxidase subunit I (IPR000883)
Domains and repeats
-
Domain
Detailed signature matches
no IPR
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Residue annotation
-
Subunit I/III inte...
-
D-pathway cd01663
-
Subunit I/VIIc int...
-
Subunit I/IV inter...
-
Subunit I/II inter...
-
Low-spin heme (hem...
-
Subunit I/VIIa int...
-
Subunit I/VIa inte...
-
Dimer interface c...
-
Putative water exi...
-
K-pathway cd01663
-
Binuclear center (...
-
Subunit I/Vb inter...
-
Putative proton ex...
-
Subunit I/VIb inte...
-
Subunit I/VIc inte...
-
Electron transfer ...
-
Subunit I/VIIIb in...
-
Subunit I/VIIb int...
Protein sequence
>MCA_mt_19351069 MVNSKFKQFVTRWLFSTNCKDMAVLYMMFAIFSGLMGTGLSLIIRLELAGPTPQMLQNNGQMFNVVISAHAIFMMFFLVM PMAVGFFGNYLVPLMLGCADMSLARLNNISFWLLVPSLLLAVASTLVETGPGTGWTVYPPLSGMQSHSGPSVDMVMFSLH ISGISSLLGAMNFMVTVMNMRTNGITYSKLTLFSWAMVMTAVLLLLSLPVTAAGLTMLTTDRNFNTSFFESAAGGDPVLY QHLFWFFGHPEVYILIMPGFGMVSHMISVYAKKPMFGKLGMVYAMASIGFLGFCVWSHHMYVVGLDTDTRAYFTAATMMI AMPTGVKIFSWLATLYGGSLRFTTPFLYTLGFMFLFTMGGVTGVALANASLDIAFHDTYYVVAHFHYVLSLGAVFSLFAG YYFWSPKVLGLYYNERLGQIQFMTLFIGANLTFMPLHFLGLNGMPRRMPNYPDAYYGWNLIASFGSLISLMSLVLFFYVI YNQLVHGLENKNTVAVANIYEPDFLESNLMFTNENNSMKATSIEWITSTPPALHTFSSPALQS
GO term prediction
Biological Process
GO:0009060 aerobic respiration
GO:0055114 oxidation-reduction process
Molecular Function
GO:0004129 cytochrome-c oxidase activity
GO:0005506 iron ion binding
GO:0009055 electron carrier activity
GO:0020037 heme binding
Cellular Component
GO:0016021 integral component of membrane
GO:0045277 respiratory chain complex IV