MCA_mt_19351063
Gene name: atp9
Description: ATP synthase subunit 9
Browser: mtDNA:21991-22225-
RNA-seq: read pairs 0, FPKM 0.0, percentile rank 0.8% (100% = highest expression)
Protein function
| Annotation: | atp9 | ATP synthase subunit 9 | |
|---|---|---|---|
| KEGG: | K02128 | ATPeF0C | F-type H+-transporting ATPase subunit c |
| EGGNOG: | 0PT0U | ATP9 | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element |
| SGD closest match: | S000007274 | OLI1 | ATP synthase subunit 9, mitochondrial |
| CGD closest match: | CAL0000186811 | ATP9 | ATP synthase subunit 9, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_mt_19350962 | 90.91% | 77 | 2e-31 | MIA_mt_19350962 |
| A0A0A1I5J0_GEOCN | 91.89% | 74 | 4e-29 | ATP synthase subunit 9, mitochondrial OS=Geotrichum candidum GN=ATP9 PE=3 SV=1 |
| A0A060RCS0_BLAAD | 78.67% | 75 | 2e-26 | ATP synthase subunit 9, mitochondrial OS=Blastobotrys adeninivorans GN=atp9 PE=3 SV=1 |
| A0A167BWE6_9ASCO | 78.67% | 75 | 5e-26 | ATP synthase subunit 9, mitochondrial OS=Sugiyamaella lignohabitans GN=OLI1 PE=3 SV=1 |
| ATP9_YARLI | 72.00% | 75 | 7e-23 | ATP synthase subunit 9, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATP9 PE=1 SV=1 |
| UniRef50_Q37695 | 72.00% | 75 | 2e-19 | ATP synthase subunit 9, mitochondrial n=31 Tax=root TaxID=1 RepID=ATP9_YARLI |
| ATP9_CANAL | 69.33% | 75 | 2e-21 | ATP synthase subunit 9, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP9 PE=3 SV=1 |
| ATP9_YEAST | 65.33% | 75 | 5e-20 | ATP synthase subunit 9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OLI1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1631
Protein family membership
- ATP synthase, F0 complex, subunit C (IPR000454)
Domains and repeats
-
Domain
Detailed signature matches
no IPR
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_mt_19351063 MNNMVLAGKYMGSGMATIGLAGAGVGMAMVFAALINGTSRNPQLRSQLFQYAILGFALAEATGTFCTMISFLLLYAV
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
GO:0015991 ATP hydrolysis coupled proton transport
Molecular Function
GO:0015078 hydrogen ion transmembrane transporter activity
Cellular Component
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)