Protein

MCA_mt_19351062

Length
255 amino acids


Gene name: atp6

Description: ATP synthase subunit a (subunit 6)

Browser: mtDNA:20537-21338+

RNA-seq: read pairs 0, FPKM 0.0, percentile rank 0.8% (100% = highest expression)

Protein function

Annotation:atp6ATP synthase subunit a (subunit 6)
KEGG:K02126ATPeF0A F-type H+-transporting ATPase subunit a
EGGNOG:0PJU9ATP6Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel
SGD closest match:S000007268ATP6ATP synthase subunit a
CGD closest match:CAL0000195054ATP6ATP synthase subunit a

Protein alignments

%idAln lengthE-value
MIA_mt_1935095381.96%2552e-144MIA_mt_19350953
A0A0A1I5A1_GEOCN72.58%2487e-130ATP synthase subunit a OS=Geotrichum candidum GN=ATP6 PE=3 SV=1
A0A060RF29_BLAAD53.20%2502e-88ATP synthase subunit a OS=Blastobotrys adeninivorans GN=atp6 PE=3 SV=1
UniRef50_A0A060RF2953.20%2504e-85ATP synthase subunit a n=2 Tax=saccharomyceta TaxID=716545 RepID=A0A060RF29_BLAAD
ATP6_YEAST54.33%2541e-84ATP synthase subunit a OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP6 PE=1 SV=2
ATP6_YARLI49.61%2541e-81ATP synthase subunit a OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATP6 PE=3 SV=2
ATP6_CANAL45.97%2481e-64ATP synthase subunit a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP6 PE=3 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0240

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PR00123 (ATPASEA)
    2. PF00119 (ATP-synt_A)
    3. MF_01393 (ATP_synth...)
    4. SSF81336 (F1F0 ATP ...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_mt_19351062
MNNMIMMSPLEQFEMNKYISLTSSFVDISWLSITNFSVYTIMVFSIMMALHTLSINNNGIIPSKWSMSVESMYSTMQSMV
YNQMGMSGQYYFPLIYVLFVFMLVSNLFSMIPYNFAMMSHLVFTVSLSSIMWLGVTILGFYNFKLEYFGLFVPAGTSLPL
VPVLVMIELLSYMARSISLGLRTGSNITAGHLLLVILGGLIFDFMSSGVLFFMLGFMPLALVLGIMCTECAIALIQAYVF
CILACSYIKEAIYLH

GO term prediction

Biological Process

GO:0015986 ATP synthesis coupled proton transport

Molecular Function

GO:0015078 hydrogen ion transmembrane transporter activity

Cellular Component

GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)