Protein
MCA_mt_19351061
Length
48 amino acids
Gene name: atp8
Description: ATP synthase subunit 8
Browser: mtDNA:20220-20367+
RNA-seq: read pairs 0, FPKM 0.0, percentile rank 0.8% (100% = highest expression)
Protein function
Annotation: | atp8 | ATP synthase subunit 8 | |
---|---|---|---|
KEGG: | K02125 | ATPeF08 | F-type H+-transporting ATPase subunit 8 |
SGD closest match: | S000007267 | ATP8 | ATP synthase protein 8 |
CGD closest match: | CAL0000189026 | ATP8 | ATP synthase protein 8 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_mt_19350952 | 81.25% | 48 | 4e-21 | MIA_mt_19350952 |
UniRef50_A0A023UMU0 | 63.83% | 47 | 6e-13 | ATP synthase F0 subunit 8 n=1 Tax=Magnusiomyces tetrasperma TaxID=1232584 RepID=A0A023UMU0_9ASCO |
A0A0A1I5R3_GEOCN | 62.50% | 48 | 4e-15 | ATPase subunit 8 OS=Geotrichum candidum GN=ATP8 PE=4 SV=1 |
A0A060REV7_BLAAD | 56.25% | 48 | 3e-13 | ARAD0ZZ00110p OS=Blastobotrys adeninivorans GN=atp8 PE=4 SV=1 |
ATP8_YEAST | 56.25% | 48 | 6e-13 | ATP synthase protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP8 PE=3 SV=1 |
ATP8_YARLI | 55.32% | 47 | 8e-13 | ATP synthase protein 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATP8 PE=3 SV=2 |
ATP8_CANAL | 39.58% | 48 | 4e-07 | ATP synthase protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP8 PE=3 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0459
Protein family membership
- ATP synthase protein 8, fungi (IPR009230)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF05933 (Fun_ATP-sy...)
-

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_mt_19351061 MPQLVPFYFMNQLVYGLSFMLILIMIFSHYILPRMLFIFLSRIFMTKL
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
GO:0015078 hydrogen ion transmembrane transporter activity
Cellular Component
GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)