Protein

MCA_mt_19351061

Length
48 amino acids


Gene name: atp8

Description: ATP synthase subunit 8

Browser: mtDNA:20220-20367+

RNA-seq: read pairs 0, FPKM 0.0, percentile rank 0.8% (100% = highest expression)

Protein function

Annotation:atp8ATP synthase subunit 8
KEGG:K02125ATPeF08 F-type H+-transporting ATPase subunit 8
SGD closest match:S000007267ATP8ATP synthase protein 8
CGD closest match:CAL0000189026ATP8ATP synthase protein 8

Protein alignments

%idAln lengthE-value
MIA_mt_1935095281.25%484e-21MIA_mt_19350952
UniRef50_A0A023UMU063.83%476e-13ATP synthase F0 subunit 8 n=1 Tax=Magnusiomyces tetrasperma TaxID=1232584 RepID=A0A023UMU0_9ASCO
A0A0A1I5R3_GEOCN62.50%484e-15ATPase subunit 8 OS=Geotrichum candidum GN=ATP8 PE=4 SV=1
A0A060REV7_BLAAD56.25%483e-13ARAD0ZZ00110p OS=Blastobotrys adeninivorans GN=atp8 PE=4 SV=1
ATP8_YEAST56.25%486e-13ATP synthase protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP8 PE=3 SV=1
ATP8_YARLI55.32%478e-13ATP synthase protein 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATP8 PE=3 SV=2
ATP8_CANAL39.58%484e-07ATP synthase protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP8 PE=3 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0459

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF05933 (Fun_ATP-sy...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_mt_19351061
MPQLVPFYFMNQLVYGLSFMLILIMIFSHYILPRMLFIFLSRIFMTKL

GO term prediction

Biological Process

GO:0015986 ATP synthesis coupled proton transport

Molecular Function

GO:0015078 hydrogen ion transmembrane transporter activity

Cellular Component

GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)