Protein
MCA_mt_19351056
Length
134 amino acids
Gene name: nad3
Description: NADH-ubiquinone oxidoreductase subunit 3
Browser: mtDNA:16975-17469+
RNA-seq: read pairs 0, FPKM 0.0, percentile rank 0.8% (100% = highest expression)
Protein function
| Annotation: | nad3 | NADH-ubiquinone oxidoreductase subunit 3 | |
|---|---|---|---|
| KEGG: | K03880 | ND3 | NADH-ubiquinone oxidoreductase chain 3 [EC:1.6.5.3] |
| EGGNOG: | 0PYXX | NADH-ubiquinone/plastoquinone oxidoreductase, chain 3 | |
| CGD closest match: | CAL0000179355 | NAD3 | NADH-ubiquinone oxidoreductase chain 3 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_mt_19350947 | 83.46% | 133 | 1e-66 | MIA_mt_19350947 |
| A0A0A1I5A0_GEOCN | 77.17% | 127 | 5e-61 | NADH-ubiquinone oxidoreductase chain 3 OS=Geotrichum candidum GN=ND3 PE=3 SV=1 |
| UniRef50_A0A023UPM7 | 66.18% | 136 | 1e-55 | NADH-ubiquinone oxidoreductase chain 3 n=1 Tax=Magnusiomyces tetrasperma TaxID=1232584 RepID=A0A023UPM7_9ASCO |
| A0A060RCV4_BLAAD | 65.55% | 119 | 6e-47 | NADH-ubiquinone oxidoreductase chain 3 OS=Blastobotrys adeninivorans GN=nd3 PE=3 SV=1 |
| A0A167BWC7_9ASCO | 58.77% | 114 | 7e-31 | NADH-ubiquinone oxidoreductase chain 3 OS=Sugiyamaella lignohabitans GN=AWJ20_5373 PE=3 SV=1 |
| NU3M_YARLI | 54.81% | 104 | 5e-29 | NADH-ubiquinone oxidoreductase chain 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ND3 PE=1 SV=1 |
| NU3M_CANAL | 45.30% | 117 | 6e-28 | NADH-ubiquinone oxidoreductase chain 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NAD3 PE=3 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0298
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_mt_19351056 MFNFNNTLYIFMMLIPMVGLALTVVNILFSETNTYGDKTGPFECGLSSFTQTRMAFTVSFILIAILFLPFDTEVTSTLPY SLALYHTNSYGLTMMLLFLLLLTVGFIFEINNKATYITKNNIKVKSDHYLSLYS
GO term prediction
Biological Process
GO:0055114 oxidation-reduction process
Molecular Function
GO:0008137 NADH dehydrogenase (ubiquinone) activity
Cellular Component
None predicted.