Protein

MCA_mt_19351036

Length
277 amino acids


Gene name: cox3

Description: Cytochrome c oxidase subunit 3

Browser: mtDNA:3823-4773+

RNA-seq: read pairs 0, FPKM 0.0, percentile rank 0.8% (100% = highest expression)

Protein function

Annotation:cox3Cytochrome c oxidase subunit 3
KEGG:K02262COX3 cytochrome c oxidase subunit 3
EGGNOG:0PJUYCOX3Subunits I, II and III form the functional core of the enzyme complex
SGD closest match:S000007283COX3Cytochrome c oxidase subunit 3
CGD closest match:CAL0000183335COX3ACytochrome c oxidase subunit 3

Protein alignments

%idAln lengthE-value
A0A0A1I5X3_GEOCN72.59%2701e-133Cytochrome c oxidase subunit 3 OS=Geotrichum candidum GN=cox3 PE=3 SV=1
MIA_mt_1935092871.38%2766e-133MIA_mt_19350928
A0A060RCV0_BLAAD60.78%2832e-106Cytochrome c oxidase subunit 3 OS=Blastobotrys adeninivorans GN=cox3 PE=3 SV=1
COX3_YARLI60.59%2691e-94Cytochrome c oxidase subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COX3 PE=3 SV=1
UniRef50_W6DHH154.81%2706e-88Cytochrome c oxidase subunit 3 n=7 Tax=Colletotrichum TaxID=5455 RepID=W6DHH1_COLLN
COX3_YEAST57.62%2691e-89Cytochrome c oxidase subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX3 PE=3 SV=3
COX3_CANAL52.40%2711e-82Cytochrome c oxidase subunit 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX3A PE=3 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0960
Predicted cleavage: 76

Protein family membership

None predicted.

Domains and repeats

1 50 100 150 200 250 277

Detailed signature matches

    1. PS50253 (COX3)
    2. SSF81452 (Cytochrom...)
    3. PF00510 (COX3)
    1. cd01665 (Cyt_c_Oxid...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Residue annotation

  1. Subunit III/VIIa i...
  2. Phospholipid bindi...
  3. Subunit I/III inte...
  4. Subunit III/VIb in...
  5. Subunit III/VIa in...
  6. Subunit III/Vb int...

Protein sequence

>MCA_mt_19351036
MNNKSNIMLNIYRQNYQLHPFHLVENSPWPFFSSFSLFGLAMNTALTSHGYMQSSIWVILGIVCVAYSMFLWFRDMVAEG
TYLGNHTLAVRNGINLGFILFVVSEALFFIGMFWAFGHSAISPTVEMGAVWPPVGIEAMGPTDLPLLNTMLLLSSGATLT
YSHHYLINGGNRFQVLFGLFLTMLLAVAFMLCQYMEYTTASFTIADGIFGSVFYLGTGFHAMHIMIGVMFLSMSFWRMYS
YQTTSSHHIGYELAVIYWHFVDVVWLMTFVVFYWWGS

GO term prediction

Biological Process

GO:0022904 respiratory electron transport chain

Molecular Function

GO:0004129 cytochrome-c oxidase activity
GO:0015002 heme-copper terminal oxidase activity

Cellular Component

GO:0016020 membrane