Protein
MCA_06515_1
Length
129 amino acids
Gene name: TRM112
Description: Multifunctional methyltransferase subunit TRM112
Browser: contigD:4458837-4459365+
RNA-seq: read pairs 799, FPKM 75.9, percentile rank 74.3% (100% = highest expression)
Protein function
| Annotation: | TRM112 | Multifunctional methyltransferase subunit TRM112 | |
|---|---|---|---|
| KEGG: | K15448 | TRM112 | multifunctional methyltransferase subunit TRM112 |
| EGGNOG: | 0PPKG | FG07440.1 | subunit Trm112 |
| SGD closest match: | S000005329 | TRM112 | Multifunctional methyltransferase subunit TRM112 |
| CGD closest match: | CAL0000194338 | orf19.3585 | RNA methylation protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02952_1 | 75.97% | 129 | 1e-73 | MIA_02952_1 |
| A0A0J9XA42_GEOCN | 65.12% | 129 | 3e-62 | Similar to Saccharomyces cerevisiae YNR046W TRM112 Subunit of tRNA methyltransferase (MTase) complexes in combination with Trm9p and Trm11p OS=Geotrichum candidum GN=BN980_GECA06s03926g PE=4 SV=1 |
| A0A1E3PHW2_9ASCO | 59.69% | 129 | 1e-58 | Trm112p-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46805 PE=4 SV=1 |
| Q59Y64_CANAL | 58.91% | 129 | 9e-55 | RNA methylation protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3585 PE=4 SV=1 |
| Q6C4P5_YARLI | 57.36% | 129 | 2e-53 | YALI0E24761p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E24761g PE=1 SV=1 |
| UniRef50_C5M4X2 | 57.36% | 129 | 4e-49 | Uncharacterized protein n=1 Tax=Candida tropicalis (strain ATCC MYA-3404 / T1) TaxID=294747 RepID=C5M4X2_CANTT |
| A0A060T552_BLAAD | 55.30% | 132 | 4e-52 | ARAD1C09174p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C09174g PE=4 SV=1 |
| TR112_YEAST | 49.25% | 134 | 4e-44 | Multifunctional methyltransferase subunit TRM112 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM112 PE=1 SV=1 |
| A0A1E4TD45_9ASCO | 44.53% | 128 | 1e-35 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_141963 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7916
Predicted cleavage: 16
Protein family membership
- Uncharacterised protein family UPF0434/Trm112 (IPR005651)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
SSF158997 (Trm112p-...)
Protein sequence
>MCA_06515_1 MKLMTTNFVQCAVRSCSKTSNAFPLKYEDVDLVQKEVDFDPQILINLLPRIDWPNLVKVCEELGNSSLPSEKPDIQDTSN EENIRFLKDLHTLLIETQIMEGKMICRNCGYTYYIKNSIPNFLLPPHLT
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.