Protein

MCA_06490_1

Length
168 amino acids


Gene name: GNA1

Description: Glucosamine 6-phosphate N-acetyltransferase

Browser: contigD:4382259-4382766-

RNA-seq: read pairs 4036, FPKM 295.1, percentile rank 91.7% (100% = highest expression)

Protein function

Annotation:GNA1Glucosamine 6-phosphate N-acetyltransferase
KEGG:K00621GNPNAT1 glucosamine-phosphate N-acetyltransferase [EC:2.3.1.4]
EGGNOG:0PNHJGNA1Glucosamine 6-phosphate
SGD closest match:S000001877GNA1Glucosamine 6-phosphate N-acetyltransferase

Protein alignments

%idAln lengthE-value
MIA_02277_164.42%1633e-79MIA_02277_1
A0A0J9XGA8_GEOCN63.35%1611e-75Similar to Saccharomyces cerevisiae YFL017C GNA1 Evolutionarily conserved glucosamine-6-phosphate acetyltransferase required for multiple cell cycle events including passage through START OS=Geotrichum candidum GN=BN980_GECA13s00593g PE=4 SV=1
A0A060TJB9_BLAAD63.35%1615e-75ARAD1D45914p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D45914g PE=4 SV=1
A0A167E3L7_9ASCO57.76%1618e-66Glucosamine 6-phosphate N-acetyltransferase OS=Sugiyamaella lignohabitans GN=GNA1 PE=4 SV=1
UniRef50_A0A167E3L757.76%1612e-62Glucosamine 6-phosphate N-acetyltransferase n=10 Tax=Fungi TaxID=4751 RepID=A0A167E3L7_9ASCO
A0A1E3PIV3_9ASCO55.83%1631e-65Acyl-CoA N-acyltransferase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_79193 PE=4 SV=1
Q6C8F2_YARLI53.37%1632e-63YALI0D20152p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D20152g PE=4 SV=1
A0A1E4TG90_9ASCO51.23%1625e-55Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_110745 PE=4 SV=1
Q5AHF9_CANAL47.30%1482e-46Glucosamine 6-phosphate N-acetyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GNA1 PE=4 SV=1
GNA1_YEAST50.63%1588e-43Glucosamine 6-phosphate N-acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GNA1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2961

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 168

Detailed signature matches

    1. SSF55729 (Acyl-CoA ...)
    1. PF00583 (Acetyltran...)
    2. PS51186 (GNAT)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd04301 (NAT_SF)

Residue annotation

  1. Coenzyme A binding...

Protein sequence

>MCA_06490_1
MPSSYLFSEDIIPASVKSSLPEGYSIRPIARDDNTKGVLETLAALTTVGDITTESFHKVFDFWKAHSGTYFTIVITDNNE
KVVSVGSIVLERKIIHNCGLVGHIEDIAVDKNQQGKKLGLNLIKALTEIGKSQGVYKIILDCAEKNVEFYKKCGYSVAGI
EMSIRFDK

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0008080 N-acetyltransferase activity

Cellular Component

None predicted.