Protein

MCA_06479_1

Length
175 amino acids

Gene name: ARL1

Description: ADP-ribosylation factor-like protein 1

Browser: contigD:4363134-4363988-

RNA-seq: read pairs 2085, FPKM 146.4, percentile rank 84.6% (100% = highest expression)

Protein function

Annotation:ARL1ADP-ribosylation factor-like protein 1
KEGG:K07942ARL1 ADP-ribosylation factor-like protein 1
EGGNOG:0PKEMFG06920.1ADP-ribosylation
SGD closest match:S000000368ARL1ADP-ribosylation factor-like protein 1
CGD closest match:CAL0000196747ARL1Arf family GTPase

Protein alignments

%idAln lengthE-value
A0A0J9X2K4_GEOCN84.88%1725e-99Similar to Saccharomyces cerevisiae YBR164C ARL1 Soluble GTPase with a role in regulation of membrane traffic OS=Geotrichum candidum GN=BN980_GECA01s02947g PE=3 SV=1
A0A060TE46_BLAAD80.81%1724e-96ARAD1D12738p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D12738g PE=3 SV=1
A0A1E3PKL5_9ASCO78.31%1665e-85Catalase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51247 PE=3 SV=1
Q6BZT6_YARLI75.29%1701e-88YALI0F31009p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F31009g PE=3 SV=2
ARL1_YEAST74.42%1729e-88ADP-ribosylation factor-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL1 PE=1 SV=4
UniRef50_P3811674.42%1722e-84ADP-ribosylation factor-like protein 1 n=443 Tax=Eukaryota TaxID=2759 RepID=ARL1_YEAST
Q5AMP3_CANAL72.67%1723e-87Arf family GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARL1 PE=3 SV=1
A0A1E4TEC1_9ASCO72.94%1704e-83Cytochrome c heme lyase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1812 PE=3 SV=1
MIA_02613_179.86%1446e-75MIA_02613_1
A0A167DBV5_9ASCO59.64%1668e-65Arf family GTPase ARF2 OS=Sugiyamaella lignohabitans GN=ARF2 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0143

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 175

Detailed signature matches

  1. Family IPR006689
    Small GTPase superfamily, ARF/SAR type
    1. PF00025 (Arf)
    2. PR00328 (SAR1GTPBP)
  2. Family IPR024156
    Small GTPase superfamily, ARF type
    1. PS51417 (ARF)
  3. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  4. Domain IPR005225
    Small GTP-binding protein domain
    1. TIGR00231
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.50...
  2. SM00175 (rab_sub_5)
  3. SM00177 (arf_sub_2)
  4. SM00178 (sar_sub_1)
  5. cd04151 (Arl1)

Residue annotation

  1. G1 box cd04151
  2. putative GAP inter...
  3. GTP/Mg2+ binding s...
  4. Switch I region cd...
  5. G2 box cd04151
  6. putative GEF inter...
  7. effector interacti...
  8. interswitch region...
  9. G3 box cd04151
  10. Switch II region c...
  11. G4 box cd04151
  12. G5 box cd04151

Protein sequence

>MCA_06479_1
MGMLWGGDKEIRILILGLDGAGKTTLLYRLQMGEVISTVPTVGFNVETLTYKNLKFNVWDIGGQTSIRPYWRCYYANTQA
VIFVVDSSDKDRIEVCATELHTMLAEDELKDAALLVFANKQDQPAALKVSDISKALGLSNLKDRSWSIMGCSAITGDGLN
EGLDWLADVIKEEHM

GO term prediction

Biological Process

GO:0007264 small GTPase mediated signal transduction

Molecular Function

GO:0005525 GTP binding

Cellular Component

GO:0005622 intracellular