Protein
MCA_06467_1
Length
284 amino acids
Gene name: POR1
Description: Mitochondrial outer membrane protein porin 1
Browser: contigD:4323948-4324803-
RNA-seq: read pairs 48075, FPKM 2084.3, percentile rank 97.8% (100% = highest expression)
Protein function
| Annotation: | POR1 | Mitochondrial outer membrane protein porin 1 | |
|---|---|---|---|
| KEGG: | K15040 | VDAC2 | voltage-dependent anion channel protein 2 |
| EGGNOG: | 0PJQV | POR1 | outer mitochondrial membrane protein porin |
| SGD closest match: | S000005000 | POR1 | Mitochondrial outer membrane protein porin 1 |
| CGD closest match: | CAL0000182381 | POR1 | Mitochondrial outer membrane protein porin |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XCK1_GEOCN | 70.83% | 288 | 2e-149 | Similar to Saccharomyces cerevisiae YNL055C POR1 Mitochondrial porin (Voltage-dependent anion channel) OS=Geotrichum candidum GN=BN980_GECA09s02100g PE=4 SV=1 |
| MIA_02169_1 | 69.93% | 286 | 6e-148 | MIA_02169_1 |
| A0A167DRM5_9ASCO | 64.79% | 284 | 3e-136 | Porin POR1 OS=Sugiyamaella lignohabitans GN=POR1 PE=4 SV=1 |
| Q6C1D2_YARLI | 59.15% | 284 | 3e-123 | YALI0F17314p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F17314g PE=4 SV=1 |
| A0A060T5D8_BLAAD | 59.15% | 284 | 8e-122 | ARAD1B06380p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B06380g PE=4 SV=1 |
| A0A1E4TL58_9ASCO | 55.79% | 285 | 3e-118 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_87360 PE=4 SV=1 |
| A0A1E3PSR7_9ASCO | 57.99% | 288 | 9e-117 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_39692 PE=4 SV=1 |
| UniRef50_A0A1E3PSR7 | 57.99% | 288 | 2e-113 | Uncharacterized protein n=3 Tax=saccharomyceta TaxID=716545 RepID=A0A1E3PSR7_9ASCO |
| VDAC_CANAL | 53.87% | 284 | 2e-105 | Mitochondrial outer membrane protein porin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=POR1 PE=1 SV=2 |
| VDAC1_YEAST | 47.55% | 286 | 6e-81 | Mitochondrial outer membrane protein porin 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POR1 PE=1 SV=4 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5002
Protein family membership
- Eukaryotic porin/Tom40 (IPR027246)
- Porin, eukaryotic type (IPR001925)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01459 (Porin_3)
-
no IPR
Unintegrated signatures
-
-
cd07306 (Porin3_VDAC)
Residue annotation
-
putative determina...
-
putative dimerizat...
Protein sequence
>MCA_06467_1 MSVPAFSDISKSSNDLLNRDFYHLAPANLEIKSKTPNGVAFTVKGKTNSKDDSIFGSLEAKYTDKATGLTLTQGWTTVNA LDTKIELSNALIPGLKSELLTTYFPDQNKRNAKLNFHFSQPNFYGRAFFDLLKGPTFIGDATFGNNGFVFGTEFAFDVST GTMNRYAAGLGYFAPTFTASVTSQSKFSIYTGSYYHKVSPATEVGAKAVYDSAASSGVNLEVGTKHQLDDSSFVKAKINS QAIAALAYSQALRPGVRLGLGVSFDTQKLNQSAHKLGLSLTFEA
GO term prediction
Biological Process
GO:0055085 transmembrane transport
GO:0098656 anion transmembrane transport
Molecular Function
GO:0008308 voltage-gated anion channel activity
Cellular Component
GO:0005741 mitochondrial outer membrane