Protein
MCA_06454_1
Length
124 amino acids
Description: Putative NADH dehydrogenase (ubiquinone) subunit
Browser: contigD:4298342-4298788-
RNA-seq: read pairs 6940, FPKM 686.0, percentile rank 95.4% (100% = highest expression)
Protein function
| Annotation: | Putative NADH dehydrogenase (ubiquinone) subunit | ||
|---|---|---|---|
| KEGG: | K03950 | NDUFA6 | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 6 |
| EGGNOG: | 0PPIW | nadh-ubiquinone oxidoreductase | |
| CGD closest match: | CAL0000176204 | orf19.6035 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02177_1 | 75.89% | 112 | 8e-61 | MIA_02177_1 |
| A0A0J9XFB5_GEOCN | 70.54% | 112 | 8e-55 | NB4M subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA13s02562g PE=3 SV=1 |
| A0A060T032_BLAAD | 62.60% | 123 | 1e-54 | ARAD1C09548p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C09548g PE=3 SV=1 |
| Q6CI60_YARLI | 58.20% | 122 | 3e-51 | YALI0A01419p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A01419g PE=3 SV=2 |
| Q5ABD5_CANAL | 53.72% | 121 | 4e-41 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6035 PE=3 SV=1 |
| UniRef50_B9W6M1 | 53.72% | 121 | 4e-37 | NADH-ubiquinone oxidoreductase [14.8 kDa] subunit, putative n=41 Tax=Saccharomycetales TaxID=4892 RepID=B9W6M1_CANDC |
| A0A1E4TLA6_9ASCO | 48.76% | 121 | 7e-36 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_23517 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2136
Protein family membership
- Complex 1 LYR protein (IPR008011)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF05347 (Complex1_LYR)
-
-
-
PIRSF006643 (NDUA6)
-
Protein sequence
>MCA_06454_1 MPTTATAFAETTRISKNPAELTKRVLALYRKFIRNAPTIVETYEISYPASLVRTKIRQEFERHRFVTDLTVRNFLYAKGQ MEFQETINYWKQQPHILKFFEEEEAVKGKPKPATFVDKFLQNSL
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.