Protein

MCA_06432_1

Length
115 amino acids


Gene name: RSM27

Description: Mitochondrial 37S ribosomal protein S27

Browser: contigD:4193574-4194044-

RNA-seq: read pairs 2170, FPKM 231.1, percentile rank 89.6% (100% = highest expression)

Protein function

Annotation:RSM27Mitochondrial 37S ribosomal protein S27
EGGNOG:0PQRNRSM27mitochondrial 37S ribosomal protein RSM27
SGD closest match:S000003447RSM27Mitochondrial 37S ribosomal protein S27
CGD closest match:CAL0000176154orf19.3297Mitochondrial 37S ribosomal protein RSM27

Protein alignments

%idAln lengthE-value
MIA_04463_174.49%984e-39MIA_04463_1
A0A0J9X5F0_GEOCN61.84%769e-26Similar to Saccharomyces cerevisiae YGR215W RSM27 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA03s00681g PE=4 SV=1
UniRef50_A0A0J9X5F061.84%762e-22Similar to Saccharomyces cerevisiae YGR215W RSM27 Mitochondrial ribosomal protein of the small subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X5F0_GEOCN
RT27_YEAST43.42%764e-15Mitochondrial 37S ribosomal protein S27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM27 PE=1 SV=1
A0A060TEL0_BLAAD45.78%838e-14ARAD1D08580p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D08580g PE=4 SV=1
Q5A937_CANAL46.25%803e-12Mitochondrial 37S ribosomal protein RSM27 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3297 PE=4 SV=1
A0A167FKT4_9ASCO42.42%662e-11Mitochondrial ribosomal protein of the small subunit OS=Sugiyamaella lignohabitans GN=AWJ20_3053 PE=4 SV=1
Q6C5T5_YARLI43.33%601e-09YALI0E15312p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E15312g PE=4 SV=1
A0A1E3PMX1_9ASCO32.31%658e-06Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46050 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9496
Predicted cleavage: 35

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_06432_1
MASSFGPSKSKLLQLTKLSKTIFQESYNPTNARRGSKVLRSSLKGHIISDYYYPNNFLKFKYLKKTFPELYLQDEHEEYR
LHINQDRRRRGKGAPPKKSEASTEEKKPGKGKKRR

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.