Protein

MCA_06411_1

Length
295 amino acids

Gene name: MRPL1

Description: 54S ribosomal protein L1, mitochondrial

Browser: contigD:4128729-4129617-

RNA-seq: read pairs 2305, FPKM 96.2, percentile rank 78.0% (100% = highest expression)

Protein function

Annotation:MRPL154S ribosomal protein L1, mitochondrial
EGGNOG:0PNGAMRPL1mitochondrial 54S ribosomal protein MRPL1
SGD closest match:S000002523MRPL154S ribosomal protein L1, mitochondrial
CGD closest match:CAL0000188096orf19.5698Mitochondrial 54S ribosomal protein MRPL1

Protein alignments

%idAln lengthE-value
A0A0J9XGY3_GEOCN74.57%2325e-90Similar to Saccharomyces cerevisiae YDR116C MRPL1 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA16s03134g PE=4 SV=1
UniRef50_A0A0J9XGY374.57%2321e-86Similar to Saccharomyces cerevisiae YDR116C MRPL1 Mitochondrial ribosomal protein of the large subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XGY3_GEOCN
MIA_00311_166.81%2322e-89MIA_00311_1
A0A167EC33_9ASCO46.56%2627e-61Ribosomal protein OS=Sugiyamaella lignohabitans GN=MRPL1 PE=3 SV=1
A0A1E3PS20_9ASCO42.31%2342e-56Ribosomal protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82053 PE=3 SV=1
RM01_YEAST45.15%2379e-5354S ribosomal protein L1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL1 PE=1 SV=1
A0A060T2Z4_BLAAD46.63%1934e-50ARAD1A12144p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A12144g PE=4 SV=1
A0A1E4TEB7_9ASCO40.25%2364e-47Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31169 PE=4 SV=1
Q6C9A2_YARLI40.00%2351e-44YALI0D12771p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D12771g PE=4 SV=1
A0A1D8PMT8_CANAL32.19%2339e-26Mitochondrial 54S ribosomal protein MRPL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5698 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9415
Predicted cleavage: 36

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 295

Detailed signature matches

  1. Family IPR028364
    Ribosomal protein L1/ribosomal biogenesis protein
    1. cd00403 (Ribosomal_L1)
    2. PF00687 (Ribosomal_L1)
  2. Family IPR002143
    Ribosomal protein L1
    1. PIRSF002155 (RPL1p_...)
  3. Domain IPR023674
    Ribosomal protein L1-like
    1. SSF56808 (Ribosomal...)
  4. Domain IPR016095
    Ribosomal protein L1, 3-layer alpha/beta-sandwich
    1. G3DSA:3.40.50...
  5. SITE IPR023673
    Ribosomal protein L1, conserved site
    1. PS01199 (RIBOSOMAL_L1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:3.30.19...

Residue annotation

  1. mRNA/rRNA interfac...

Protein sequence

>MCA_06411_1
MMSLRSTAWSALKRPQRICSETSLFVSQIGSIRNYAKKDDSAPKVNSKLLAQQRERALAQEQNKRREQKKMNRLRESARN
CLDTPLYMDTPTALRYLRASEVGQPASSTTITLSVRVVADRGVQPLSGSIRFPKSLSEDQAIAVFTTNPELAQIAKDAGA
AIVGGEELIQQVKDGNINFTKALATPDIVPKLNSVAKILGPKGLMPSTRRGTVSNNIEELILNSKGAVDFRQGGVPVVSV
PVGMAHFTDIEIVKNLIAAINEIRAAANKAISKRPVVLGQTSISSTHGPGIVINI

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome

Cellular Component

GO:0015934 large ribosomal subunit