Protein
MCA_06362_1
Length
312 amino acids
Gene name: RPP0
Description: 60S acidic ribosomal protein P0
Browser: contigD:3992481-3993420-
RNA-seq: read pairs 72817, FPKM 2874.5, percentile rank 98.3% (100% = highest expression)
Protein function
Annotation: | RPP0 | 60S acidic ribosomal protein P0 | |
---|---|---|---|
KEGG: | K02941 | RP-LP0 | large subunit ribosomal protein LP0 |
EGGNOG: | 0PGUR | RPP0 | 60S acidic ribosomal protein P0 |
SGD closest match: | S000004332 | RPP0 | 60S acidic ribosomal protein P0 |
CGD closest match: | CAL0000189629 | RPP0 | 60S acidic ribosomal protein P0 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9XI47_GEOCN | 81.09% | 312 | 2e-158 | 60S acidic ribosomal protein P0 OS=Geotrichum candidum GN=BN980_GECA16s00483g PE=3 SV=1 |
MIA_00829_1 | 81.65% | 267 | 8e-157 | MIA_00829_1 |
A0A060T5H9_BLAAD | 78.52% | 270 | 6e-150 | 60S acidic ribosomal protein P0 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B04598g PE=3 SV=1 |
A0A167FL90_9ASCO | 78.21% | 312 | 4e-150 | 60S acidic ribosomal protein P0 OS=Sugiyamaella lignohabitans GN=RPP0 PE=3 SV=1 |
UniRef50_A0A1B7SC03 | 75.82% | 273 | 6e-143 | Uncharacterized protein n=4 Tax=Dikarya TaxID=451864 RepID=A0A1B7SC03_9ASCO |
A0A1D8PQS0_CANAL | 76.28% | 312 | 7e-147 | 60S acidic ribosomal protein P0 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPP0 PE=3 SV=1 |
A0A1E3PRK0_9ASCO | 75.08% | 313 | 8e-144 | 60S acidic ribosomal protein P0 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_21766 PE=3 SV=1 |
A0A1E4TEH8_9ASCO | 71.57% | 313 | 6e-139 | 60S acidic ribosomal protein P0 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_101721 PE=3 SV=1 |
RLA0_YEAST | 68.91% | 312 | 1e-130 | 60S acidic ribosomal protein P0 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPP0 PE=1 SV=2 |
Q6CEP2_YARLI | 72.29% | 314 | 3e-130 | 60S acidic ribosomal protein P0 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B14146g PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0197
Protein family membership
- Ribosomal protein L10P (IPR001790)
- 60S acidic ribosomal protein P0 (IPR030670)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF00466 (Ribosomal_L10)
-
-
-
PIRSF039087 (L10E)
-

Unintegrated signatures
-
PF00428 (Ribosomal_60s)
-
SSF160369 (Ribosoma...)
-
cd05795 (Ribosomal_...)
-
mobidb-lite (disord...)
Residue annotation
-
23S rRNA interface...
-
putative Interface...
Protein sequence
>MCA_06362_1 MGGASEKKTEYFAKLRELIDEYKSIFLVGVDNVSSQQMHEIRKALRGKAVLLMGKNTMWRRAFRDFVEEVPALENILPLL KGNVGFVFTNDDLKTIRDIVIENRVAAPARAGAIAPKDVFVPGGNTGMEPGKTSFFQALGIPTKITRGTIEITNDVQVLT AGSKVGPSEATLLNMLNISPFTYGMTVEHVYDNGQVFSPSILDITDDELVGHFLSAVKTIASISLAANYPTLPAVSHSII NHYKELLALSIATEYTFEGSESIKDRLANPDAYAAAAPAAAAGGASESAAAEEAPAEEEEESDDDMGFGLFD
GO term prediction
Biological Process
GO:0042254 ribosome biogenesis
Molecular Function
None predicted.
Cellular Component
GO:0005622 intracellular