Protein

MCA_06328_1

Length
248 amino acids


Gene name: BET5

Description: Trafficking protein particle complex subunit BET5

Browser: contigD:3870571-3871391+

RNA-seq: read pairs 1092, FPKM 54.2, percentile rank 67.0% (100% = highest expression)

Protein function

Annotation:BET5Trafficking protein particle complex subunit BET5
KEGG:K20300TRAPPC1 trafficking protein particle complex subunit 1
EGGNOG:0PNSFBET5Transport protein particle subunit bet5
SGD closest match:S000004542BET5Trafficking protein particle complex subunit BET5
CGD closest match:CAL0000196764orf19.302TRAPP subunit

Protein alignments

%idAln lengthE-value
MIA_03311_141.99%2817e-56MIA_03311_1
A0A0J9X2T6_GEOCN33.47%2482e-40Similar to Saccharomyces cerevisiae YML077W BET5 Component of the TRAPP (Transport protein particle) complex OS=Geotrichum candidum GN=BN980_GECA01s05367g PE=4 SV=1
UniRef50_A0A0J9X2T633.47%2483e-37Similar to Saccharomyces cerevisiae YML077W BET5 Component of the TRAPP (Transport protein particle) complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X2T6_GEOCN
A0A060SXU1_BLAAD33.47%2482e-34ARAD1A07326p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A07326g PE=4 SV=1
Q6CF47_YARLI30.08%2461e-27YALI0B10318p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B10318g PE=4 SV=2
A0A1E3PKT8_9ASCO32.37%1392e-19Snare-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50856 PE=4 SV=1
BET5_YEAST31.82%1101e-09Trafficking protein particle complex subunit BET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET5 PE=1 SV=1
Q5AEG6_CANAL27.86%1403e-09TRAPP subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.302 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0293

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 248

Detailed signature matches

    1. PF04099 (Sybindin)
    2. SM01399 (Sybindin_2)
    1. SSF64356 (SNARE-like)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MCA_06328_1
MTIYSFWIFDKHCNCVYVKDFNQQRNNRKSFQGAGLIGGTTNPNAEYNTSVGLTPSGEFVYRKVLPPLPTLNAPAQLNQQ
LRGLNISSINLNNNQNPNINNELLESELGKLIFGVVFSLRNISRKLLVPPFVTETFTADPSINMDSSTSIDDNSTKNYTD
DTFITYSTSKYKTHFYETPSNMRFVLVSDPNTPSQLNSLKHIYSNLYVEYAIKNPLFKVDPTSSTQVLGNDLLVLGIEAY
IASLPHFD

GO term prediction

Biological Process

GO:0006810 transport

Molecular Function

None predicted.

Cellular Component

GO:0030008 TRAPP complex