Protein

MCA_06322_1

Length
253 amino acids

Gene name: SNF8

Description: Vacuolar-sorting protein SNF8

Browser: contigD:3861355-3862117-

RNA-seq: read pairs 556, FPKM 27.0, percentile rank 49.8% (100% = highest expression)

Protein function

Annotation:SNF8Vacuolar-sorting protein SNF8
KEGG:K12188SNF8 ESCRT-II complex subunit VPS22
EGGNOG:0PHTSFG04120.1ELL complex subunit Eap30
SGD closest match:S000005923SNF8Vacuolar-sorting protein SNF8
CGD closest match:CAL0000184989VPS22Vacuolar-sorting protein SNF8

Protein alignments

%idAln lengthE-value
MIA_04507_165.46%2493e-115MIA_04507_1
A0A0J9X345_GEOCN62.00%2501e-108Vacuolar-sorting protein SNF8 OS=Geotrichum candidum GN=BN980_GECA01s00868g PE=3 SV=1
A0A167DTM3_9ASCO54.80%2501e-95Vacuolar-sorting protein SNF8 OS=Sugiyamaella lignohabitans GN=SNF8 PE=3 SV=1
UniRef50_A0A167DTM354.80%2504e-92Vacuolar-sorting protein SNF8 n=6 Tax=Saccharomycetales TaxID=4892 RepID=A0A167DTM3_9ASCO
A0A1E3PMR6_9ASCO53.01%2496e-91Vacuolar-sorting protein SNF8 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50628 PE=3 SV=1
A0A060T6F7_BLAAD49.60%2502e-82Vacuolar-sorting protein SNF8 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C19558g PE=3 SV=1
Q6CEI6_YARLI48.59%2494e-80Vacuolar-sorting protein SNF8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B15334g PE=3 SV=1
A0A1E4TAU1_9ASCO43.09%2466e-67Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3539 PE=4 SV=1
SNF8_YEAST39.52%2482e-62Vacuolar-sorting protein SNF8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF8 PE=1 SV=1
Q59N31_CANAL40.65%2465e-53Vacuolar-sorting protein SNF8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS22 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2020

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 253

Detailed signature matches

  1. Family IPR007286
    EAP30
    1. PF04157 (EAP30)
  2. Family IPR016689
    ESCRT-2 complex, Snf8
    1. PIRSF017215 (ESCRT2...)
  3. Domain IPR011991
    Winged helix-turn-helix DNA-binding domain
    1. G3DSA:1.10.10.10
    2. SSF46785 ("Winged h...)

Protein sequence

>MCA_06322_1
MRRVGIAAFDNKNQAAQQYSNLSQTLLEERSKEFSAQLEVFRSSLAYFAKEHAVEIRTNPAFRTEFARMCASIGVDPLAS
SNTGKSSGPGSIWASMLGNEVNDFYYELDVKIIEISRITRDENGGLIPVKAVQARLRNSSPPVDASLDDIERAVKSLQIL
GKGFELMTIAGTKYIMSVPVEMSLDQSAVLEACEVMGYVTVSLLRDNFKWEKIRIKKVLNDMISIGTLWIDTQAEGETNY
WAPSWIEKARNVD

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.