Protein

MCA_06313_1

Length
331 amino acids


Gene name: OTU1

Description: Ubiquitin thioesterase OTU1

Browser: contigD:3836130-3837126-

RNA-seq: read pairs 1204, FPKM 44.8, percentile rank 62.9% (100% = highest expression)

Protein function

Annotation:OTU1Ubiquitin thioesterase OTU1
KEGG:K13719OTU1 ubiquitin thioesterase OTU1 [EC:3.1.2.-]
EGGNOG:0PJ6GOTU1Ubiquitin thioesterase OTU1
SGD closest match:S000001850OTU1Ubiquitin thioesterase OTU1
CGD closest match:CAL0000186385orf19.2933Ubiquitin-specific protease

Protein alignments

%idAln lengthE-value
A0A167C9L1_9ASCO45.97%3354e-95Otu1p OS=Sugiyamaella lignohabitans GN=OTU1 PE=4 SV=1
UniRef50_A0A1E3Q1F642.53%3482e-75Uncharacterized protein n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3Q1F6_LIPST
A0A0J9XEK2_GEOCN60.48%2108e-78Similar to Saccharomyces cerevisiae YFL044C OTU1 Deubiquitylation enzyme that binds to the chaperone-ATPase Cdc48p OS=Geotrichum candidum GN=BN980_GECA12s01165g PE=4 SV=1
Q6C989_YARLI44.02%3434e-76YALI0D13046p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D13046g PE=4 SV=1
A0A060T623_BLAAD43.37%3325e-76ARAD1B07612p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B07612g PE=4 SV=1
A0A1E4TKI5_9ASCO37.61%3353e-61Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30410 PE=4 SV=1
A0A1E3PQ70_9ASCO51.23%2034e-54Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_68979 PE=4 SV=1
A0A1D8PCR2_CANAL32.58%3539e-47Ubiquitin-specific protease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2933 PE=4 SV=1
OTU1_YEAST29.88%3388e-39Ubiquitin thioesterase OTU1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OTU1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0439

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 331

Detailed signature matches

    1. PS50802 (OTU)
    2. PF02338 (OTU)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF54001 (Cysteine ...)
  2. mobidb-lite (disord...)

Protein sequence

>MCA_06313_1
MKLKARFPNKAKVVTIEGTDKDVTLAKLFDALFDDAPTVESIKVGIPPRPVVLDDVSAPLATIGIRNGDQIHVAPGDLLS
TSPEIESNQTTSSKQSSSNPLSSKKQIPAQGNNAKPGQNSVQVRAGRFGFLRLRVMEDDNSCLFRAVNYGINPLEDMMRE
LRAIVAKYIRADPEKYSDAILGKPREEYIRWIQTSNAWGGAIELDILARHFDITIVSLDVATLRKDFFNEGQDNFIVIVY
SGIHYDAVALVPSEDDEAGPEFDTTIFTVDEKGSEVLEQLGVLGQLLKQKHYYTDTGSFELRCDICNAIIVGEKGADEHA
KATGHTSFKEL

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.