Protein

MCA_06263_1

Length
457 amino acids

Gene name: MAP2

Description: Methionine aminopeptidase 2

Browser: contigD:3714095-3715469-

RNA-seq: read pairs 4500, FPKM 121.4, percentile rank 82.0% (100% = highest expression)

Protein function

Annotation:MAP2Methionine aminopeptidase 2
KEGG:K01265map methionyl aminopeptidase [EC:3.4.11.18]
EGGNOG:0PI4BMAP2Removes the N-terminal methionine from nascent proteins (By similarity)
SGD closest match:S000000187MAP2Methionine aminopeptidase 2
CGD closest match:CAL0000186537MAP2Methionine aminopeptidase 2

Protein alignments

%idAln lengthE-value
MIA_05188_171.86%3980.0MIA_05188_1
A0A167E5P7_9ASCO73.91%3680.0Methionine aminopeptidase 2 OS=Sugiyamaella lignohabitans GN=MAP2 PE=3 SV=1
A0A060T2V6_BLAAD73.10%3680.0Methionine aminopeptidase 2 OS=Blastobotrys adeninivorans GN=MAP2 PE=3 SV=1
UniRef50_O6008570.92%3680.0Methionine aminopeptidase 2 n=113 Tax=Eukaryota TaxID=2759 RepID=MAP2_SCHPO
A0A1E3PKJ0_9ASCO67.57%3673e-179Methionine aminopeptidase 2 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=MAP2 PE=3 SV=1
A0A0J9XKC1_GEOCN67.03%3671e-178Methionine aminopeptidase 2 OS=Geotrichum candidum GN=MAP2 PE=3 SV=1
A0A1E4TL69_9ASCO67.30%3671e-173Methionine aminopeptidase 2 OS=Tortispora caseinolytica NRRL Y-17796 GN=MAP2 PE=3 SV=1
MAP2_YARLI61.43%4072e-169Methionine aminopeptidase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MAP2 PE=3 SV=1
MAP2_YEAST64.09%3628e-160Methionine aminopeptidase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAP2 PE=1 SV=4
MAP2_CANAL60.88%3634e-153Methionine aminopeptidase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MAP2 PE=3 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2967

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 457

Detailed signature matches

  1. Family IPR001714
    Peptidase M24, methionine aminopeptidase
    1. PR00599 (MAPEPTIDASE)
  2. Family IPR002468
    Peptidase M24A, methionine aminopeptidase, subfamily 2
    1. cd01088 (MetAP2)
    2. MF_03175 (MetAP_2_euk)
    3. TIGR00501
  3. Domain IPR000994
    Peptidase M24
    1. SSF55920 (Creatinas...)
    2. PF00557 (Peptidase_M24)
  4. Domain IPR011991
    Winged helix-turn-helix DNA-binding domain
    1. SSF46785 ("Winged h...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:3.90.23...
  3. mobidb-lite (disord...)

Residue annotation

  1. active site cd01088

Protein sequence

>MCA_06263_1
MPPKNKKNTKPAASKNKKAPAAKSTADDDDAFLDALIAQMDKEKLNAPKSDGGASDAKSGVPKKELTPEDDDYDDGANVE
IVIPEDGSAAKQTTPPRVGLSKIYITGEYPVGEECEYTFGEENLKRTTDEEKRALDRAEKAQEQYRDLRKAAEAHRQARQ
YAQKNIKPGMSMTRIANLIENTTRALTEGKDLLDAGIGFPTGLSLNECAAHYTPNKGDTTILKEKDVLKVDIGVHVHGNI
IDSAFTMTFDDKYDQLLAAVKDATNTGIREAGIDVRLGDIGAAVQETMESYEIELDGKTYPIVPIRNLNGHNINPYTIHG
GKSVPIVKTGDQTKMEEGEVFAIETFGSTGRGYVHNEGECSHYARVKDVNVPLRINSAKTLLNVIDKNFGTLPFCRRYLD
RLGQEKYALALRTLVQNGVVQDYPPLVDAPGSYTAQFEHTIILRPTCKEVISRGDDY

GO term prediction

Biological Process

GO:0006508 proteolysis

Molecular Function

GO:0004177 aminopeptidase activity
GO:0008235 metalloexopeptidase activity

Cellular Component

None predicted.