Protein
MCA_06242_1
Length
204 amino acids
Description: Mitochondrial 37S ribosomal protein MRP21
Browser: contigD:3655725-3656340-
RNA-seq: read pairs 2638, FPKM 159.0, percentile rank 85.5% (100% = highest expression)
Protein function
| Annotation: | Mitochondrial 37S ribosomal protein MRP21 | ||
|---|---|---|---|
| SGD closest match: | S000000186 | MRP21 | 37S ribosomal protein MRP21, mitochondrial |
| CGD closest match: | CAL0000192450 | CAALFM_CR02950CA | Mitochondrial 37S ribosomal protein MRP21 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XLF0_GEOCN | 56.82% | 88 | 2e-29 | Similar to Saccharomyces cerevisiae YBL090W MRP21 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA32s02100g PE=4 SV=1 |
| UniRef50_A0A0J9XLF0 | 56.82% | 88 | 5e-26 | Similar to Saccharomyces cerevisiae YBL090W MRP21 Mitochondrial ribosomal protein of the small subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XLF0_GEOCN |
| MIA_05119_1 | 58.43% | 89 | 2e-26 | MIA_05119_1 |
| A0A060TJ18_BLAAD | 42.86% | 105 | 4e-17 | ARAD1D43186p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D43186g PE=4 SV=1 |
| A0A1E3PDG1_9ASCO | 36.89% | 103 | 2e-13 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53683 PE=4 SV=1 |
| RT21_YEAST | 35.44% | 79 | 7e-07 | 37S ribosomal protein MRP21, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP21 PE=1 SV=1 |
| Q6C4W4_YARLI | 27.43% | 175 | 5e-07 | YALI0E23199p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E23199g PE=4 SV=1 |
| Q5A1Z1_CANAL | 31.40% | 86 | 2e-06 | Mitochondrial 37S ribosomal protein MRP21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR02950CA PE=4 SV=1 |
| A0A1E4TGZ0_9ASCO | 37.68% | 69 | 9e-06 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_44653 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.8894
Predicted cleavage: 44
Protein family membership
- Ribosomal protein S21 (IPR001911)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01165 (Ribosomal_S21)
-
Protein sequence
>MCA_06242_1 MSSVFLSNISRLAAARSLPITSEIASRAALTSLRPFSTTRSCYDDPKSGSNRNLADTLKLFGELEKPSAHGKNSSIGNLQ LPLSQTGITGGRKSMMDFDDPSSLIKKEDFANLYYLSPETIPRTGPKAGRSIVVGGPMDLNRALRVLHRKNVENNVRATS LNQNRYEKPGKKRQRIRIERNKRKFKQTVKHLFELVSEARRKGY
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005840 ribosome