Protein
MCA_06238_1
Length
194 amino acids
Gene name: MRPL49
Description: 54S ribosomal protein L49, mitochondrial
Browser: contigD:3642690-3643275+
RNA-seq: read pairs 3196, FPKM 202.5, percentile rank 88.2% (100% = highest expression)
Protein function
Annotation: | MRPL49 | 54S ribosomal protein L49, mitochondrial | |
---|---|---|---|
EGGNOG: | 0PP2I | Ribosomal protein | |
SGD closest match: | S000003632 | MRPL49 | 54S ribosomal protein L49, mitochondrial |
CGD closest match: | CAL0000185233 | orf19.5161 | Mitochondrial 54S ribosomal protein YmL49 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_05121_1 | 57.22% | 194 | 3e-61 | MIA_05121_1 |
A0A0J9X834_GEOCN | 61.11% | 144 | 4e-61 | Similar to Saccharomyces cerevisiae YJL096W MRPL49 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA05s00241g PE=4 SV=1 |
UniRef50_A0A0J9X834 | 61.11% | 144 | 8e-58 | Similar to Saccharomyces cerevisiae YJL096W MRPL49 Mitochondrial ribosomal protein of the large subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X834_GEOCN |
A0A060T4H4_BLAAD | 52.22% | 180 | 7e-50 | ARAD1C45188p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C45188g PE=4 SV=1 |
A0A167DG30_9ASCO | 60.17% | 118 | 8e-39 | Mitochondrial 54S ribosomal protein YmL49 OS=Sugiyamaella lignohabitans GN=MRPL49 PE=4 SV=1 |
A0A1E3PL58_9ASCO | 40.34% | 119 | 9e-29 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82895 PE=4 SV=1 |
RN49_YEAST | 44.74% | 114 | 3e-28 | 54S ribosomal protein L49, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL49 PE=1 SV=2 |
A0A1E4THT6_9ASCO | 36.28% | 113 | 9e-23 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_122521 PE=4 SV=1 |
Q6C2D1_YARLI | 37.90% | 124 | 1e-21 | YALI0F08877p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F08877g PE=4 SV=1 |
A0A1D8PRA1_CANAL | 34.26% | 108 | 7e-19 | Mitochondrial 54S ribosomal protein YmL49 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5161 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9977
Predicted cleavage: 47
Protein family membership
- Ribosomal protein L21-like (IPR028909)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
NON_CYTOPLASM... (N...)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
Protein sequence
>MCA_06238_1 MFRQTYASRACSLAAASTSRIVSRAPAFAPRLFSSYRALANESKQASATESQAKNEFPSFLPPPKNTYTTITPSKEELQP LKIGGALYAVIHIHDRSFMVTEGDEIILPVDLRDTTVGSILDFDHVSKIGTREHTLTGGPAIDPSVFSIKGVVVEKTRER RRIHEKTQRRIRHVRHVVTKNRMTIIRISELKLK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0005840 ribosome